BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C13 (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47140.1 68418.m05811 zinc finger (GATA type) family protein ... 28 5.9 At5g62630.1 68418.m07861 expressed protein 27 7.8 >At5g47140.1 68418.m05811 zinc finger (GATA type) family protein contains Pfam:PF00320 GATA zinc finger domain Length = 470 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +1 Query: 94 KDFKETFSSDSGLNKTNTAFAFSSMNTSVSTIKSTMIEVPPNAESCKQGTYLDNTGVCR 270 K ++E F+ + +T F +++ S +S+ V N+ESC Q D+T C+ Sbjct: 82 KPYQENFTVKRANLEFHTGFKRKALDEEASN-RSSSGSVVSNSESCAQSNAWDSTFPCK 139 >At5g62630.1 68418.m07861 expressed protein Length = 696 Score = 27.5 bits (58), Expect = 7.8 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +1 Query: 85 SPIKDFKETFSSDSGLNKTNTAFAFSSMNT---SVSTIKSTMIEVPPNAESCKQGTYL 249 SP+ F E SSDS L + S +N S S I N + C GTYL Sbjct: 505 SPLSPFGENVSSDSNLTFPILGYNHSEVNKHEGSASIIGGYFYR--SNTDPCSYGTYL 560 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,794,409 Number of Sequences: 28952 Number of extensions: 212884 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -