BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C10 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 3.6 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 24 4.8 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 6.3 AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 23 6.3 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 8.3 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 8.3 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.6 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = -3 Query: 388 TLSPNPGMCVSVRLTPWPFTLSSATPA-----VAAPSFCLLVKSKEPIAL 254 ++SP P + V P P L S TPA AP+ LL KS +P L Sbjct: 360 SVSPVPSLPVRSSPEPSPVLLRSPTPAKKPLISVAPASKLLSKSLQPSTL 409 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 108 YYIQHYEEPELLTSSRVRRDAHGALT 185 + +QH+ +P+L SS +HG T Sbjct: 1328 HQLQHHHQPQLSQSSHHSSSSHGGPT 1353 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 401 QSESLPQRXPRHHSEGFRHQKYARYRXCTQL 493 Q + QR P HH + +HQ Y T L Sbjct: 31 QQQQNHQRMPHHHQQQQQHQVKCHYLDPTGL 61 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 157 SAGTRTELSRSTPMVPLVLELKYPLLV 237 + G T ++ + P +LEL+YP+++ Sbjct: 1163 TGGVHTHMTNTRITDPEILELRYPIVL 1189 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -2 Query: 377 EPGDVCIRETYSVAVYIIQCHSSGCSA 297 E G V I E+Y++A+Y+++ + +G A Sbjct: 56 EDGHV-IWESYAIAIYLVEKYGNGDDA 81 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 7 PFSTQTCSGRSSFYCLSLCASAF 75 PF T C LS+CAS F Sbjct: 152 PFGTMYCKISQFVAILSICASVF 174 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 151 LESAGTRTELSRSTPM 198 ++SAGT T+L+ STP+ Sbjct: 51 VKSAGTATKLATSTPV 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,726 Number of Sequences: 2352 Number of extensions: 15407 Number of successful extensions: 36 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -