BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C05 (584 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 33 0.11 At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 33 0.11 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 31 0.57 At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase fa... 31 0.57 At5g57660.1 68418.m07205 zinc finger (B-box type) family protein... 29 1.7 At5g24930.1 68418.m02952 zinc finger (B-box type) family protein... 29 2.3 At3g02380.1 68416.m00223 zinc finger protein CONSTANS-LIKE 2 (CO... 29 2.3 At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) f... 29 3.0 At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger ... 28 4.0 At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger ... 28 4.0 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 28 4.0 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 28 4.0 At3g59870.1 68416.m06681 expressed protein hypothetical protein ... 28 4.0 At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT d... 27 9.2 At4g29310.1 68417.m04190 expressed protein 27 9.2 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 33.5 bits (73), Expect = 0.11 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 267 SRCTPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 127 SR P + R RGG RG GRGRG G + P+ +S Sbjct: 223 SRRLPIHNQQGGGMRGGRGGFRARGRGNGGRGRGGGRGNGKKPVEKS 269 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 33.5 bits (73), Expect = 0.11 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = +3 Query: 435 LDAHDNDWFVSRHELFPIRAPLMSLEHCIAP-----FLDQCDADEDHRITLAE 578 LD +D D ++S EL PI + + EH A + Q D+D+D R+TLAE Sbjct: 311 LDKND-DGYLSDVELLPIISKIHPTEHYYAKQQADYIISQADSDKDRRLTLAE 362 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 31.1 bits (67), Expect = 0.57 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 170 LPRPLGAVPRGAVPPRADRVLRDLQGNAGVQRERNVRLPAAH 295 LPRP+ P G +PP + + + G+ G+Q N ++ +H Sbjct: 608 LPRPMQMPPHGHMPPPSMPMSHQMPGSMGMQGGMNPQMSQSH 649 >At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase family protein low similarity to 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] GI:13660755; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 533 Score = 31.1 bits (67), Expect = 0.57 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 187 SEWSRQRQRCRYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLIS 32 S++SR QRCR S ++ + +T + + HSL +++PC IS Sbjct: 13 SQFSRSSQRCRLQSLTNLDFNFLGFNTKQTNLSASSHSLNNRSVSTPCFSIS 64 >At5g57660.1 68418.m07205 zinc finger (B-box type) family protein contains Pfam domain, PF00643: B-box zinc finger Length = 355 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 375 EAESNLTRRWTNAAIWKWCDLDAHDNDWFVSRHELFPIRAPLMSLEHCIA 524 +A + +T + AA+ CD D H + SRHE P+ S E +A Sbjct: 66 QAPAAVTCKADAAALCVSCDADIHSANPLASRHERVPVETFFDSAETAVA 115 >At5g24930.1 68418.m02952 zinc finger (B-box type) family protein similar to CONSTANS-like protein 1 GI:4091804 from [Malus x domestica] Length = 406 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 7/63 (11%) Frame = +3 Query: 375 EAESNLTRRWTNAAIWKWCDLDAHDNDWFVSRHELFPIRAPLM-------SLEHCIAPFL 533 +A +++T + AA+ CD D H + RHE P+ P S++H FL Sbjct: 98 QAPAHVTCKADAAALCVTCDRDIHSANPLARRHERVPV-TPFYDSVSSDGSVKHTAVNFL 156 Query: 534 DQC 542 D C Sbjct: 157 DDC 159 >At3g02380.1 68416.m00223 zinc finger protein CONSTANS-LIKE 2 (COL2) identical to putative flowering-time gene CONSTANS (COL2) GB:AAB67879 GI:1507699 SP:Q96502 (Arabidopsis thaliana) Length = 347 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 411 AAIWKWCDLDAHDNDWFVSRHELFPIRAPLMSLEHC--IAPFLDQCDADEDHRITLAEW 581 A++ CD + H + RH+ PI PL S C +AP D DED R +A W Sbjct: 76 ASLCTACDAEIHSANPLARRHQRVPI-LPL-SANSCSSMAPSETDADNDEDDR-EVASW 131 >At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) family protein similar to SP|Q9RHV9 Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) {Bacillus stearothermophilus}; contains Pfam profile: PF00152 tRNA synthetases class II (D, K and N) Length = 602 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 258 TPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSA 160 +PA C S ++ S+ T + PSGR R SA Sbjct: 40 SPALRCASAASSSSSSATTAETSKPSGRNRRSA 72 >At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar), PF04677: Protein similar to CwfJ C-terminus 1, PF04676: Protein similar to CwfJ C-terminus 2 Length = 593 Score = 28.3 bits (60), Expect = 4.0 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 2/111 (1%) Frame = -2 Query: 439 SRSHHFQMAALVQRRVRLDSASRSMRR*WGVSSRRSARSRIMLNSQSRMRRGKSDISFSL 260 S H FQ + +QR+ R ++A+RS + W S S S ++++ SL Sbjct: 354 SYKHEFQDESSIQRKPRSENANRS-KECWFCLSSPSVESHLIVSVGESFYCALP--KGSL 410 Query: 259 HSGISLQVP*YSICTWWYCAPRHSSEWSRQRQRCR--YTSQSDDQVSLKFV 113 L +P + +P SE SR + R Y SQ +D V + V Sbjct: 411 VEDHILIIPIEHLPNTLVLSPEVESELSRYQNGLRNCYKSQGNDAVFFELV 461 >At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar), PF04677: Protein similar to CwfJ C-terminus 1, PF04676: Protein similar to CwfJ C-terminus 2 Length = 404 Score = 28.3 bits (60), Expect = 4.0 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 2/111 (1%) Frame = -2 Query: 439 SRSHHFQMAALVQRRVRLDSASRSMRR*WGVSSRRSARSRIMLNSQSRMRRGKSDISFSL 260 S H FQ + +QR+ R ++A+RS + W S S S ++++ SL Sbjct: 165 SYKHEFQDESSIQRKPRSENANRS-KECWFCLSSPSVESHLIVSVGESFYCALP--KGSL 221 Query: 259 HSGISLQVP*YSICTWWYCAPRHSSEWSRQRQRCR--YTSQSDDQVSLKFV 113 L +P + +P SE SR + R Y SQ +D V + V Sbjct: 222 VEDHILIIPIEHLPNTLVLSPEVESELSRYQNGLRNCYKSQGNDAVFFELV 272 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 234 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 127 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 303 SRACAAGSLTFRSRCTPAFPCKSRS-TRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 127 SR+ + G +SR P +SRS +RS +P+ A S R R A T RSP +RS Sbjct: 199 SRSPSRGRSYSKSRSRGRSPSRSRSRSRSRSKSRSPK--AKSLR-RSPAKSTSRSPRSRS 255 Query: 126 R 124 R Sbjct: 256 R 256 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 234 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 127 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 >At3g59870.1 68416.m06681 expressed protein hypothetical protein F6E13.7 - Arabidopsis thaliana, PIR:T00674 Length = 288 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 469 RDTNQSLSCASRSHHFQMAALVQRRVRLDSASRSM 365 R ++ S SC+S+S FQ+ ++ +RR R S S M Sbjct: 33 RRSSSSTSCSSQSQSFQLFSVRRRRSRSSSPSIPM 67 >At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT domain-containing protein contains Pfam profiles: PF00533 BRCA1 C Terminus (BRCT) domain, PF00004 ATPase family associated with various cellular activities (AAA) Length = 956 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 234 RSTRSARGGTAPRGTAPSGRGRGSAVG 154 +S RGG A G + GRGRG G Sbjct: 154 KSAGRGRGGRAAPGASTGGRGRGGGRG 180 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 255 PAFPCKSRSTRSARGGTAPRGTAPSGRG 172 P F CK S R+ R + P G S RG Sbjct: 186 PVFSCKFSSDRNGRSRSLPSGFTYSSRG 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,105,556 Number of Sequences: 28952 Number of extensions: 234701 Number of successful extensions: 935 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -