BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C04 (526 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42905.1 68418.m05230 hypothetical protein 29 1.9 At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase fa... 29 2.5 At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase fa... 28 3.3 >At5g42905.1 68418.m05230 hypothetical protein Length = 258 Score = 29.1 bits (62), Expect = 1.9 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +2 Query: 365 WYGWKNHCQHGLPDISDC*EQALNFIKQLLMNIYKFQL 478 W+GWK C + + + C + F+K+ ++ +Y+ L Sbjct: 86 WWGWKWRCSNIFGENTKC-RDRVKFVKEWVVEVYRAHL 122 >At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase family protein simlar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 585 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 122 MSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCH 277 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 451 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDLH 502 >At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 594 Score = 28.3 bits (60), Expect = 3.3 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 122 MSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCH 277 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 460 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSNNSDRYAGGDLH 511 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,860,742 Number of Sequences: 28952 Number of extensions: 212249 Number of successful extensions: 503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -