BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C01 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19130.1 68415.m02233 S-locus lectin protein kinase family pr... 29 3.0 >At2g19130.1 68415.m02233 S-locus lectin protein kinase family protein contains Pfam domains PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain and PF01453: Lectin (probable mannose binding) Length = 828 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 279 QPRFQCQSIRH*KPAKYSSSSELQHCRCRSGLHVQGQ-DWCICD 407 QPR QCQ R+ S CRC G Q DW + D Sbjct: 285 QPRQQCQVYRYCGSFGICSDKSEPFCRCPQGFRPMSQKDWDLKD 328 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,734,498 Number of Sequences: 28952 Number of extensions: 300768 Number of successful extensions: 712 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -