BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B22 (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 24 4.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.8 bits (49), Expect = 4.7 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 51 LPAAPQSAIMNRSLIILLVSCVLAAAMVPRSRRSVTTNNENSSTANIKICAPQTP 215 LP+ PQ ++ + S + +M R R N +SSTA++ C +TP Sbjct: 227 LPSRPQLLLLE----LCKRSSFRSLSMHKRRTRKQNKNPTHSSTAHMAGCTGETP 277 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 135 PRSRRSVTTNNENSSTANIKICAPQTPCAWSVYRP 239 PR + TT STA AP T WS P Sbjct: 178 PRPPTTTTTTVWTDSTATTTTHAPTTTTTWSDLPP 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,949 Number of Sequences: 2352 Number of extensions: 16036 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -