BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B18 (424 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 9e-09 SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) 42 3e-04 SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 28 2.8 SB_47204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 56.4 bits (130), Expect = 9e-09 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 14 MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR 127 M K ++KG+SAINEVVTREYT+NLHKR+HG+ R Sbjct: 769 MVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYR 806 Score = 53.2 bits (122), Expect = 9e-08 Identities = 33/101 (32%), Positives = 53/101 (52%), Gaps = 3/101 (2%) Frame = +2 Query: 89 LHKRLHGVGFKKRAPRAIKEIRRFAEKQMGTPDVRVDTR---LNKYLWSKGVRNVPFXXX 259 +H G F + K +++ +K+ + V TR +N + G+ NVP+ Sbjct: 750 IHNAARGCNFFLLLDFSFKMVKKTDKKKGRSAINEVVTREYTINLHKRIHGM-NVPYRVR 808 Query: 260 XXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 382 N+DEDS HKL+TLVT V V++ KGLQT+ V++ + Sbjct: 809 VRLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVESEE 849 >SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) Length = 776 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +2 Query: 239 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 364 NVP+ N+DEDS HKL+TLVT V V++ K L E Sbjct: 2 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKVLADE 43 >SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 28.7 bits (61), Expect = 2.1 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +2 Query: 2 STTTMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEI 151 ST A + K K INEV+T Y + L KR R IKE+ Sbjct: 201 STLNFASRAKKIKNKPEINEVITPRYPPGEGEVLDDASIIKRYKRQIKEL 250 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 28.3 bits (60), Expect = 2.8 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 100 TSRCWFQEACTPCYQGDPEIR*KT---NGYSRRKSRYPPKQIS 219 TS Q A PC QG I T +G+S +K +PP+ IS Sbjct: 906 TSSYATQGALNPCAQGSLSIGPHTGSSSGHSEQKGAHPPRSIS 948 >SB_47204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 105 TVLVSRSVHPVLSRRSGDSLKNKWVLQ 185 + L S SVHPVL R G +N LQ Sbjct: 168 STLQSMSVHPVLCERQGSCTENTQYLQ 194 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 233 LLLTKDICLGGYLLLRLEYPFVFQRISG 150 L LT + LGG LR EYP +R +G Sbjct: 1569 LQLTSPLMLGGLHSLRSEYPITSKRYTG 1596 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,123,758 Number of Sequences: 59808 Number of extensions: 284321 Number of successful extensions: 592 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -