BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B16 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 27 0.27 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 5.8 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 5.8 Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. 23 7.6 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 7.6 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 27.5 bits (58), Expect = 0.27 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 159 ANPDPFFSHPSNGPSGNYEPISTGPAFVDFYHPNYPP 269 A+PD F H S P + +S ++ P +PP Sbjct: 370 AHPDHFLDHRSPSPQRGNQSLSQMTEILEAIQPEFPP 406 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 5.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 287 SRPWWEVY 310 SRPWWE Y Sbjct: 79 SRPWWERY 86 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.0 bits (47), Expect = 5.8 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 242 RFLSSQLSTRAIRLPSRPWWEVYVSY*LAILKLGEMIINL-IIFSKF*FSN 391 R + Q+ T A P RP+W V + A KL ++L IF + SN Sbjct: 29 RIWNIQMETPADHNPERPFWVVGLQNDEAARKLASRSMSLRCIFELWAHSN 79 >Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. Length = 209 Score = 22.6 bits (46), Expect = 7.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 231 PAFVDFYHP 257 P F DFYHP Sbjct: 108 PRFADFYHP 116 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 22.6 bits (46), Expect = 7.6 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 180 SHPSNGPSGNYEPISTG---PAFVDFYHPNYPPERYDY 284 + P P+G P G P Y P+Y P+ YD+ Sbjct: 378 TQPYQLPNGAILPEGVGVILPNLAFHYDPDYFPDPYDF 415 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,928 Number of Sequences: 2352 Number of extensions: 11560 Number of successful extensions: 106 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -