SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_B14
         (586 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione S-tran...    25   2.4  
AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       23   5.5  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   9.6  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   9.6  

>AF515521-1|AAM61888.1|  233|Anopheles gambiae glutathione
           S-transferase u1 protein.
          Length = 233

 Score = 24.6 bits (51), Expect = 2.4
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 192 LISHSICFLLLYLYVFTMSLYNLVTIF 272
           L++H +CF L +LY   +S Y +  IF
Sbjct: 92  LVNHRLCFNLAFLYP-QISAYVMAPIF 117


>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 23.4 bits (48), Expect = 5.5
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = -2

Query: 111 QSILNEFQ*YCG*KNLKDRSFKTVPVNCSDLFYIPL 4
           + +L+E Q +C   +++DR+ +     CS +  IPL
Sbjct: 813 KDVLDESQ-FCNETSVRDRNCRQEFCECSHVLQIPL 847


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -3

Query: 440  SNSLSKTLCPPPLS 399
            +N LS T  PPPLS
Sbjct: 1253 NNGLSTTTVPPPLS 1266


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -3

Query: 440  SNSLSKTLCPPPLS 399
            +N LS T  PPPLS
Sbjct: 1249 NNGLSTTTVPPPLS 1262


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 529,169
Number of Sequences: 2352
Number of extensions: 9163
Number of successful extensions: 61
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 55927431
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -