BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B14 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15540.1 68414.m01869 oxidoreductase, 2OG-Fe(II) oxygenase fa... 30 1.3 At4g30190.1 68417.m04292 ATPase 2, plasma membrane-type, putativ... 27 7.0 At2g33570.1 68415.m04114 expressed protein 27 7.0 >At1g15540.1 68414.m01869 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to GS-AOP loci [GI:16118889, GI:16118887, GI:16118891, GI:16118893]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 320 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 429 KQNPLPPSPFHHDNIYEYIDII 364 K +PL +PFHHD + EY + + Sbjct: 281 KDHPLAYNPFHHDGLLEYYETL 302 >At4g30190.1 68417.m04292 ATPase 2, plasma membrane-type, putative / proton pump 2, putative / proton-exporting ATPase, putative strong similarity to SP|P19456 ATPase 2, plasma membrane-type (EC 3.6.3.6) (Proton pump 2) {Arabidopsis thaliana}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00690: Cation transporter/ATPase, N-terminus Length = 948 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 207 ICFLLLYLYVFTMSLY-NLVTIFIKGAG*IWSFKFWDHEYVDNFLLITFKFFVK 365 I FL+ L +++Y N I+G G W+ W + V F L FKF ++ Sbjct: 789 IAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIR 842 >At2g33570.1 68415.m04114 expressed protein Length = 496 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 162 FFLEYHLYVYLQQENKVQSILNEF 91 FF + Y+YL N ++S+L+EF Sbjct: 328 FFFDVDEYIYLPHGNTLESVLDEF 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,643,315 Number of Sequences: 28952 Number of extensions: 192699 Number of successful extensions: 486 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -