BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B08 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 25 0.48 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 7.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.8 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 25.4 bits (53), Expect = 0.48 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 5/31 (16%) Frame = +2 Query: 251 KTTGLHIQVQVG---GAPLADV--LDLAAYC 328 ++TGLH+Q++VG GA +A + L + YC Sbjct: 509 RSTGLHLQIRVGVHSGAVVAGIVGLKMPRYC 539 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 369 SSGSVNNESTPTSWQYAARSKTSASGAPPTCT 274 SSGS NN+++ S + + + + S PPT T Sbjct: 610 SSGS-NNQTSSASRENTSNTTSMESFKPPTLT 640 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 335 VGVDSLLTLPELYFKPATVAELVSYVELV 421 +GV SLLTL + K VSY++ V Sbjct: 279 LGVTSLLTLSTQHAKSQASLPPVSYLKAV 307 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 345 STPTSWQYAARSKTSASGAPPTCT 274 S+P+S + R++ A G PP T Sbjct: 1483 SSPSSPVLSVRTQGQAPGIPPAAT 1506 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 345 STPTSWQYAARSKTSASGAPPTCT 274 S+P+S + R++ A G PP T Sbjct: 1479 SSPSSPVLSVRTQGQAPGIPPAAT 1502 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,928 Number of Sequences: 438 Number of extensions: 3796 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -