BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B07 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0421 + 17417851-17418840 41 0.001 09_04_0410 + 17362751-17363698 35 0.052 09_04_0411 + 17366559-17367497 35 0.069 03_06_0249 + 32638112-32639140 33 0.16 01_01_0378 - 2953514-2954341,2954388-2954504 33 0.21 08_02_0997 + 23409932-23410894 33 0.28 09_04_0412 + 17369935-17370873 32 0.37 06_02_0263 - 13566621-13569875 31 0.64 07_01_0446 - 3371829-3372132,3374691-3375673 31 0.85 09_04_0240 + 15958110-15958305,15959586-15960763 31 1.1 09_04_0239 + 15954995-15956242 31 1.1 07_01_0448 - 3383706-3384761 31 1.1 07_01_0445 - 3365244-3366227 31 1.1 02_05_0955 - 33056171-33057256 31 1.1 01_01_0370 + 2895685-2895717,2895892-2896944 31 1.1 09_02_0110 + 4375082-4375084,4375252-4375485 30 2.0 09_02_0106 + 4347024-4347536,4349619-4349700,4350499-4350747,435... 30 2.0 09_02_0096 - 4221935-4222231 30 2.0 08_02_1485 - 27466761-27467753 30 2.0 07_03_1465 - 26729872-26730909 30 2.0 06_01_0781 + 5846501-5847490 30 2.0 08_02_0995 - 23401390-23402379 29 2.6 06_01_0780 + 5824367-5825335 29 2.6 03_02_0620 + 9916684-9917336,9919219-9919492,9920502-9920585,992... 29 2.6 12_01_0904 + 8791474-8792261,8792935-8793037,8794009-8794055,879... 29 3.4 11_02_0016 - 7380933-7382027 29 3.4 11_02_0015 - 7355989-7357092 29 3.4 09_04_0380 - 17117134-17118093 29 3.4 09_04_0361 - 16948740-16948860,16948951-16949018,16949424-169495... 29 3.4 06_03_0585 - 22528082-22530100 29 3.4 06_03_0580 + 22489184-22491202 29 3.4 01_05_0639 + 23873735-23873814,23873932-23874148,23874259-238744... 29 3.4 09_04_0413 + 17372852-17373787 29 4.5 07_03_1469 - 26742772-26743848 29 4.5 07_01_0447 - 3377666-3378673 29 4.5 01_05_0637 + 23860857-23860936,23861057-23861273,23861388-238615... 29 4.5 09_04_0683 - 19431034-19431495,19431632-19431997,19432055-194323... 28 6.0 09_04_0409 + 17359459-17360622 28 6.0 09_04_0378 - 17091407-17092369 28 6.0 07_03_1467 - 26736859-26736868,26737769-26738439 28 6.0 02_02_0123 + 7015905-7015928,7015975-7016105,7017675-7017940,701... 28 6.0 11_04_0039 + 12679350-12680057,12680136-12680582,12680670-126815... 28 7.9 11_03_0217 - 11828305-11828343,11828449-11828487,11828573-118288... 28 7.9 11_02_0018 - 7412309-7413328 28 7.9 04_04_0052 + 22386553-22387506 28 7.9 04_03_0461 - 16165126-16165419,16165947-16166195,16168510-161686... 28 7.9 02_02_0570 - 11591854-11592054,11593388-11593507,11594205-115945... 28 7.9 01_01_0379 - 2956396-2957409 28 7.9 >09_04_0421 + 17417851-17418840 Length = 329 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSG-DADLHG-PEYLVSR-NIIVITFNYRL 567 LP+LVF HGGG+ GS DA HG L +R +IV++ YRL Sbjct: 79 LPVLVFFHGGGFCLGSAFDAATHGHANRLAARAGVIVVSVEYRL 122 >09_04_0410 + 17362751-17363698 Length = 315 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHG---PEYLVSRNIIVITFNYRL 567 LP+LVF HGGG+ S D+ + + + ++V++ +YRL Sbjct: 74 LPVLVFFHGGGFLIESADSSTYHNYVNPFAAAAGVVVVSVDYRL 117 >09_04_0411 + 17366559-17367497 Length = 312 Score = 34.7 bits (76), Expect = 0.069 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHG--PEYLVSRNIIVITFNYRL 567 LP+LV+ HGGG+ S D A H + ++V++ NYRL Sbjct: 73 LPVLVYFHGGGFIIESADSATYHNYLNSVAAAAGVLVVSVNYRL 116 >03_06_0249 + 32638112-32639140 Length = 342 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDAD-LHGPEYLVSRNI--IVITFNYRL 567 LP+LV+ HGGGY GS + D H ++ + +V++ +YRL Sbjct: 77 LPVLVYFHGGGYFIGSFEMDNFHACCLRLAHELPAVVLSADYRL 120 >01_01_0378 - 2953514-2954341,2954388-2954504 Length = 314 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADL-HGPEYLVSRNI--IVITFNYRL 567 LP+LV+ HGGGY G+ D + HG + + +V++ YRL Sbjct: 73 LPVLVYFHGGGYCIGALDQSICHGFCLRAAYELPAVVLSVQYRL 116 >08_02_0997 + 23409932-23410894 Length = 320 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGS-GDADLHG-PEYLVSR-NIIVITFNYRL 567 LP++V++HGGG GS DA HG L +R +V++ +YRL Sbjct: 73 LPVVVYLHGGGLVVGSAADALEHGFANRLCARARALVVSVDYRL 116 >09_04_0412 + 17369935-17370873 Length = 312 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHG--PEYLVSRNIIVITFNYRL 567 LP+LV+ HGGG+ S D A H + ++V++ +YRL Sbjct: 73 LPVLVYFHGGGFIIESADSATYHNYLNSAAAAAGVLVVSVDYRL 116 >06_02_0263 - 13566621-13569875 Length = 1084 Score = 31.5 bits (68), Expect = 0.64 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = +1 Query: 4 DMARYFAWTLFTLIIVI--NVDATPKPSPCNVIARTESGWVCGVTRWAE-----EGGLYA 162 D+ Y A TL T+I I + D P P+P N +R VCG + E + GLY Sbjct: 72 DLPDYLARTLHTVIHAIPTHADDAPAPAPQNPASRGTGARVCGKDKAEERVRDGDPGLYQ 131 Query: 163 SFRG 174 RG Sbjct: 132 VCRG 135 >07_01_0446 - 3371829-3372132,3374691-3375673 Length = 428 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHGPEYLVSRNI--IVITFNYRL 567 LP++V+ HGGG+ GS + H ++ + +V++F+YRL Sbjct: 81 LPVVVYFHGGGFCIGSCTWPNFHAGCLRLAAELPAVVLSFDYRL 124 >09_04_0240 + 15958110-15958305,15959586-15960763 Length = 457 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADL-HG-PEYLVSR-NIIVITFNYRL 567 LP++V++HGG + GS A + H E L +R +V++ +YRL Sbjct: 116 LPLVVYVHGGAFCTGSASARMFHDYAESLSARAAAVVVSVDYRL 159 >09_04_0239 + 15954995-15956242 Length = 415 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDA-DLHG-PEYLVSR-NIIVITFNYRL 567 LP++V++HGG + GS A H E L +R +V++ +YRL Sbjct: 94 LPLVVYVHGGAFCSGSASAPPFHRYAESLAARAAAVVVSVDYRL 137 >07_01_0448 - 3383706-3384761 Length = 351 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHG--PEYLVSRNIIVITFNYRL 567 LP+LV+ HGGG+ GS A++H +V++ YRL Sbjct: 91 LPVLVYFHGGGFCLGSCTWANVHSFCLRLAADAGAVVLSAGYRL 134 >07_01_0445 - 3365244-3366227 Length = 327 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHGPEYLVSRNI--IVITFNYRL 567 +P++ + HGGG+ GSG + H ++ + +V++F+YRL Sbjct: 76 VPVVAYFHGGGFCIGSGRWPNFHAWCLRLAAELPAVVLSFDYRL 119 >02_05_0955 - 33056171-33057256 Length = 361 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADL-HG-PEYLVSR-NIIVITFNYRL 567 LP++V++HGG + GS A + H E L +R +V++ +YRL Sbjct: 90 LPLVVYVHGGAFCTGSASARMFHDYAESLSARAAAVVVSVDYRL 133 >01_01_0370 + 2895685-2895717,2895892-2896944 Length = 361 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD 498 LP+LV+ HGGGY G+ D Sbjct: 102 LPVLVYFHGGGYCIGALD 119 >09_02_0110 + 4375082-4375084,4375252-4375485 Length = 78 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP+S+ +T++G+G + + ++TI Sbjct: 7 PIVHPNSILVVTINGIGLVIEAVYLTI 33 >09_02_0106 + 4347024-4347536,4349619-4349700,4350499-4350747, 4351594-4351646,4353064-4353159,4353289-4353423 Length = 375 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP+S+ +T++G+G + + ++TI Sbjct: 63 PIVHPNSILVVTINGIGLVIEAVYLTI 89 >09_02_0096 - 4221935-4222231 Length = 98 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP+S+ +T++G+G + + ++TI Sbjct: 63 PIVHPNSILVVTINGIGLVIEAVYLTI 89 >08_02_1485 - 27466761-27467753 Length = 330 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +1 Query: 436 TLGLPILVFIHGGGY-SFGSGDADLHGPEYLVSRNI--IVITFNYRL 567 T LP++++ HGGG+ F +G H ++ + IV++ +YRL Sbjct: 76 TSKLPVILYFHGGGFVLFSTGSVFYHASCEAMAAAVPAIVVSLDYRL 122 >07_03_1465 - 26729872-26730909 Length = 345 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGY-SFGSGDADLHGPEYLVSRNI--IVITFNYRL 567 LP++V+ HGGG+ F + +SR + +V++ NYRL Sbjct: 90 LPVVVYFHGGGFVLFSAASRPYDALCRRISRGVGAVVVSVNYRL 133 >06_01_0781 + 5846501-5847490 Length = 329 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHGPEYL----VSRNIIVITFNYRL 567 LP++V+ HGG Y GS AD YL I+ + YRL Sbjct: 80 LPVVVYYHGGAYVVGSA-ADPFTHSYLNGLVAEAGILAVALEYRL 123 >08_02_0995 - 23401390-23402379 Length = 329 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHG---PEYLVSRNIIVITFNYRL 567 LP++V+ HGGG+ S + +H + + ++ ++ +YRL Sbjct: 72 LPVVVYFHGGGFVVHSAFSRVHSRFLNALVAAAGVVAVSVDYRL 115 >06_01_0780 + 5824367-5825335 Length = 322 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHGP--EYLVSR-NIIVITFNYRL 567 LPILV+ HGGG+ S + + L SR ++ ++ YRL Sbjct: 75 LPILVYFHGGGFMVESATSPTYHRYLNALASRARVVAVSVEYRL 118 >03_02_0620 + 9916684-9917336,9919219-9919492,9920502-9920585, 9921295-9921356,9921699-9921762 Length = 378 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = -1 Query: 432 ALTRCAPVLIVSVTR*LRWQSLEGHVDVGVDARLAKTLGLHY 307 ALTR A L + V L W +E + DV ARL +T GL Y Sbjct: 117 ALTRMAHTLRL-VPPPLLWVVVEANPDVAATARLLRTTGLMY 157 >12_01_0904 + 8791474-8792261,8792935-8793037,8794009-8794055, 8795180-8795717 Length = 491 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHGPE-YLVSR--NIIVITFNYRLNVFGFLSLNSTSIPGN 615 LP++V HGG ++ G+ D+ + V+R + IV+ YRL + P Sbjct: 158 LPVIVQFHGGAFATGAADSAANDAFCRRVARLCDAIVVAVGYRL-------APESRYPA- 209 Query: 616 NGLRDMVTLLKWVKRNA 666 D VT+LKW+ + A Sbjct: 210 -AFEDGVTVLKWIAKQA 225 >11_02_0016 - 7380933-7382027 Length = 364 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 436 TLGLPILVFIHGGGYSF 486 T LP++VF HGGG++F Sbjct: 86 TKPLPVVVFFHGGGFAF 102 >11_02_0015 - 7355989-7357092 Length = 367 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +1 Query: 445 LPILVFIHGGGYSF 486 LP++VF HGGG++F Sbjct: 104 LPVIVFFHGGGFAF 117 >09_04_0380 - 17117134-17118093 Length = 319 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGDADLHGPEY--LVSR-NIIVITFNYRL 567 LPILVF HGG + GS +V+R +I ++ +YRL Sbjct: 76 LPILVFFHGGYFVVGSASCPKRHRNINDIVARARLIAVSVDYRL 119 >09_04_0361 - 16948740-16948860,16948951-16949018,16949424-16949510, 16949626-16949694,16949786-16949854,16949944-16950765 Length = 411 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/65 (27%), Positives = 21/65 (32%) Frame = -2 Query: 533 LLTRYSGPWRSASPDPKEYPPPCMNTNIGRPRVXXXXXXXXXXXXXXLGDFVGRASRGTW 354 L T S P S SP P PPP +I + G SR W Sbjct: 164 LATSSSAPPSSPSPSP---PPPAPAPSIRPKKALVSSASSSPAIARSSGGSGAAMSRSNW 220 Query: 353 MLAWM 339 + WM Sbjct: 221 LSRWM 225 >06_03_0585 - 22528082-22530100 Length = 672 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 317 PRVLARRASTPTSTCPSRLCQRSHRVTLTIR 409 P L R+ STP+ P+RL S +V +T+R Sbjct: 55 PAALLRQLSTPSPLLPTRLLSLSAQVPVTVR 85 >06_03_0580 + 22489184-22491202 Length = 672 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 317 PRVLARRASTPTSTCPSRLCQRSHRVTLTIR 409 P L R+ STP+ P+RL S +V +T+R Sbjct: 55 PAALLRQLSTPSPLLPTRLLSLSAQVPVTVR 85 >01_05_0639 + 23873735-23873814,23873932-23874148,23874259-23874420, 23876037-23876357 Length = 259 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP+S+ +T++G+G V T++ I Sbjct: 63 PVVHPNSILVVTINGIGLLVEGTYLLI 89 >09_04_0413 + 17372852-17373787 Length = 311 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSG-DADLHG--PEYLVSRNIIVITFNYRL 567 LP+LVF HGG + S HG + ++ ++ YRL Sbjct: 72 LPVLVFFHGGAFVIESAFSTTYHGYAASLAAAAGVVAVSVEYRL 115 >07_03_1469 - 26742772-26743848 Length = 358 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYS-FGSGDADLHG--PEYLVSRNIIVITFNYRL 567 +P++V+ HGGG++ F A G ++V++ NYRL Sbjct: 104 MPVMVYYHGGGFALFSPAVAPFDGVCRRLCGDVGVVVVSVNYRL 147 >07_01_0447 - 3377666-3378673 Length = 335 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD-ADLHGPEYLVSRNI--IVITFNYRL 567 LP+LV+ HGGG+ S + + H ++ + +V++ +YRL Sbjct: 80 LPVLVYFHGGGFCIASFELPNFHAGALRLAGELPAVVLSADYRL 123 >01_05_0637 + 23860857-23860936,23861057-23861273,23861388-23861549, 23862850-23863155 Length = 254 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP+S+ +T++G+G V T++ I Sbjct: 63 PIVHPNSILVVTINGIGLIVEGTYLFI 89 >09_04_0683 - 19431034-19431495,19431632-19431997,19432055-19432326, 19433621-19433686,19433924-19433978,19434509-19434577, 19435200-19435307,19435394-19435462,19435883-19436038, 19436089-19436229,19436514-19436568,19437103-19437233, 19437382-19437486 Length = 684 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 442 REYRLDSMRSSPDRQRHSVTSLAEPRGARGCWRGCTP 332 R Y+LDS + P +V + G RG W+G P Sbjct: 179 RLYKLDSEKPRPYGTIQAVREVYRESGIRGFWKGLIP 215 >09_04_0409 + 17359459-17360622 Length = 387 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGY---SFGSGDADLHGPEYLVSRNIIVITFNYRL 567 LP++VF HGG + S GS + + ++V++ +YRL Sbjct: 148 LPVVVFFHGGAFFIESAGSETYHNYVNSLAAAAGVLVVSVDYRL 191 >09_04_0378 - 17091407-17092369 Length = 320 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSFGSGD---ADLHGPEYLVSRNIIVITFNYRL 567 LPIL+F H G + GS + + S ++ + NYRL Sbjct: 76 LPILLFFHAGYFVVGSASWPPVHRYTNSVVASARVVAVAVNYRL 119 >07_03_1467 - 26736859-26736868,26737769-26738439 Length = 226 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 445 LPILVFIHGGGYSF---GSGDADLHGPEYLVSRNIIVITFNYRL 567 LP++V+ HGGG++ S D +V++ NYRL Sbjct: 101 LPVVVYFHGGGFALLTAASSQYDALCRRLCRELRAVVVSVNYRL 144 >02_02_0123 + 7015905-7015928,7015975-7016105,7017675-7017940, 7018239-7018327,7018716-7018811,7018874-7018969, 7019121-7019251,7020123-7020177,7020645-7020800, 7021238-7021306,7021392-7021499,7022128-7022196, 7022743-7022797,7023031-7023227 Length = 513 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 442 REYRLDSMRSSPDRQRHSVTSLAEPRGARGCWRGCTP 332 R Y+LDS + P +V + G RG W+G P Sbjct: 331 RLYKLDSEKPRPYGTIQAVREVYRESGIRGFWKGLIP 367 >11_04_0039 + 12679350-12680057,12680136-12680582,12680670-12681556, 12681635-12681805,12681872-12682160,12682390-12682428 Length = 846 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 58 VDATPKP-SPCNVIARTESGWVCGVTRWAEEGGLYASFRGVPYAKQPVGHLRFQE 219 VDA P SP +++R S +CGV + L F+ VP A++ + L F+E Sbjct: 30 VDAVGLPTSPRKILSRFRS--ICGVIGRQKFSILQDDFKLVPAAEKDIASLTFKE 82 >11_03_0217 - 11828305-11828343,11828449-11828487,11828573-11828861, 11828944-11829114,11829193-11830079,11830167-11830346, 11830692-11831399 Length = 770 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 58 VDATPKP-SPCNVIARTESGWVCGVTRWAEEGGLYASFRGVPYAKQPVGHLRFQE 219 VDA P SP +++R S +CGV + L F+ VP A++ + L F+E Sbjct: 30 VDAVGLPTSPRKILSRFRS--ICGVIGRQKFSILQDDFKLVPVAEKDIAWLTFKE 82 >11_02_0018 - 7412309-7413328 Length = 339 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 436 TLGLPILVFIHGGGYSF 486 T LP++VF HGGG+++ Sbjct: 81 TKPLPVVVFFHGGGFAY 97 >04_04_0052 + 22386553-22387506 Length = 317 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 445 LPILVFIHGGGYSFGS 492 LP++V+ HGGG+ GS Sbjct: 76 LPVVVYFHGGGFVIGS 91 >04_03_0461 - 16165126-16165419,16165947-16166195,16168510-16168645, 16171251-16171469,16172738-16173116,16173660-16173918, 16176052-16176315 Length = 599 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 200 PTGCLA*GTPLKLAYRPPSSAHR 132 P G L+ G P K+++R S+AHR Sbjct: 28 PVGLLSAGAPAKVSFRRQSNAHR 50 >02_02_0570 - 11591854-11592054,11593388-11593507,11594205-11594583, 11594897-11594933,11595293-11595335 Length = 259 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 125 PHTHPDSVRAITLHGLGFGVASTFITI 45 P HP S+ IT++G G + T+I + Sbjct: 63 PAVHPHSMLVITINGTGMAIELTYIAL 89 >01_01_0379 - 2956396-2957409 Length = 337 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 445 LPILVFIHGGGYSFGS 492 LP+LV HGGGY G+ Sbjct: 80 LPVLVCFHGGGYCLGT 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,958,471 Number of Sequences: 37544 Number of extensions: 475539 Number of successful extensions: 1609 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 1543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1607 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -