BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B06 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9527| Best HMM Match : MFS_1 (HMM E-Value=0.022) 27 5.2 SB_22369| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_9527| Best HMM Match : MFS_1 (HMM E-Value=0.022) Length = 631 Score = 27.5 bits (58), Expect = 5.2 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = +1 Query: 142 KSLLRCGVNNGHLDSDYNVVGHRQLMATDSPGRKLYNIIRRWPEWLENVDSYKE*YGYYS 321 K++ G H + V ++++T S R W +WL + D YKE Y+ Sbjct: 192 KAVAGVGALGAHGQPSGSQVSPAEILSTQSVADT--RTCRSWRQWLNDPDFYKEAIAYFP 249 Query: 322 I 324 + Sbjct: 250 L 250 >SB_22369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 26.6 bits (56), Expect = 9.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 114 LVGVVISYNRDSKSFPVVRVSGHANVHPTGSFIYFCV 4 L + S RDS S V + GHA H T + ++ CV Sbjct: 22 LASMTFSKCRDSMSIYDVALIGHAYKHVTATSLHDCV 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,781,579 Number of Sequences: 59808 Number of extensions: 271469 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -