BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B06 (440 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93374-3|CAB07558.2| 363|Caenorhabditis elegans Hypothetical pr... 27 6.0 Z81592-1|CAB04725.1| 695|Caenorhabditis elegans Hypothetical pr... 27 6.0 AF273815-1|AAG15164.1| 365|Caenorhabditis elegans nuclear recep... 27 6.0 Z49128-8|CAA88960.2| 989|Caenorhabditis elegans Hypothetical pr... 27 8.0 AL021171-6|CAA15960.2| 989|Caenorhabditis elegans Hypothetical ... 27 8.0 >Z93374-3|CAB07558.2| 363|Caenorhabditis elegans Hypothetical protein C06C6.4 protein. Length = 363 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 139 LKSLLRCGVNNGHLDSDYNVVGHRQ 213 ++ LL C ++N H+ DY ++ H Q Sbjct: 337 IEELLACELHNVHIHEDYRLILHEQ 361 >Z81592-1|CAB04725.1| 695|Caenorhabditis elegans Hypothetical protein T16G1.1 protein. Length = 695 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 129 LFCCWLVGVVISYNRDSKSFPVVRVSGHANVH-PTGSFIY 13 +F CWL +S +K F + +H P+G+ +Y Sbjct: 4 IFLCWLAIATVSQTVSAKKFMKIFADAGIGIHCPSGNKVY 43 >AF273815-1|AAG15164.1| 365|Caenorhabditis elegans nuclear receptor NHR-63 protein. Length = 365 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 139 LKSLLRCGVNNGHLDSDYNVVGHRQ 213 ++ LL C ++N H+ DY ++ H Q Sbjct: 339 IEELLACELHNVHIHEDYRLILHEQ 363 >Z49128-8|CAA88960.2| 989|Caenorhabditis elegans Hypothetical protein M03C11.8 protein. Length = 989 Score = 26.6 bits (56), Expect = 8.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 76 LRITVIGNYNSHQPTAEQIDALKSLLRCGVNNGHL 180 +R+ GN S A+ +DA K+LL +NNGHL Sbjct: 13 VRVAHQGNPQSSSLQAD-MDAKKALLSQNLNNGHL 46 >AL021171-6|CAA15960.2| 989|Caenorhabditis elegans Hypothetical protein M03C11.8 protein. Length = 989 Score = 26.6 bits (56), Expect = 8.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 76 LRITVIGNYNSHQPTAEQIDALKSLLRCGVNNGHL 180 +R+ GN S A+ +DA K+LL +NNGHL Sbjct: 13 VRVAHQGNPQSSSLQAD-MDAKKALLSQNLNNGHL 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,332,106 Number of Sequences: 27780 Number of extensions: 209485 Number of successful extensions: 409 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -