BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B02 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 40 0.002 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 34 0.099 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 34 0.099 SB_15403| Best HMM Match : CH (HMM E-Value=0) 34 0.099 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.23 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 32 0.30 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 0.70 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 31 0.70 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.2 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 30 1.6 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.6 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 30 1.6 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 29 2.8 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 29 2.8 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 29 3.7 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 4.9 SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) 28 4.9 SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) 27 8.6 SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNP 502 CMR C T E NPVCGSD +TY NP Sbjct: 118 CMRRC--TKELNPVCGSDGKTYDNP 140 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNP---GRLTC 517 + C+R CP + PVCG+D +TY N G TC Sbjct: 42 DPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAATC 74 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCA 520 ++C C + PVCGSD TYSNP L A Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSA 197 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 33.9 bits (74), Expect = 0.099 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCA 520 ++C CP + PVCGSD TYSNP L A Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSNPCMLRSA 68 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 33.9 bits (74), Expect = 0.099 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 C C T E+ PVCGSD +TY NP L ++C + +S Sbjct: 42 CNEAC--TREYAPVCGSDGKTYPNPCALE-VESCKTNTRIS 79 Score = 33.1 bits (72), Expect = 0.17 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 EC + C T ++ PVCGSD +TY+N L +AC Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYANLCNLE-VEAC 226 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSN 499 EC R C T E PVCG+D +TY N Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDN 139 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSN 499 EC + C T E+ P CG+D TY N Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPN 300 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 33.9 bits (74), Expect = 0.099 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQ 523 +C+ + T E+ PVCGSD TY+N LT A+ Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNNLCLLTAAR 753 Score = 31.9 bits (69), Expect = 0.40 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 452 PEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLSR 553 P ++P+CG+D +TY+N L A AC S+ R Sbjct: 1241 PAYDPICGTDGKTYNNDKDLESA-ACAQQTSIVR 1273 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSN 499 EC R+CP PVCG D QTY N Sbjct: 972 ECPRSCPSVNY--PVCGDDGQTYDN 994 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 33.9 bits (74), Expect = 0.099 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 440 CP--VTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 CP VT ++NPVCGSD +TY N + Q C Sbjct: 10 CPMAVTADYNPVCGSDGRTYPNRASME-VQGC 40 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 32.7 bits (71), Expect = 0.23 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 EC CP E +PVCG D +TYS+ + A+AC S++ Sbjct: 802 ECNTECP--SEASPVCGQDGRTYSSTCAMD-ARACQAQTSIA 840 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C R CP+T P+CGSD + Y N Sbjct: 661 CSRACPIT--LRPLCGSDGKNYWN 682 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNP---GRLTC 517 ++C+R CP + PVCG+D +TY N G TC Sbjct: 22 DKCVRPCPAIND--PVCGTDGKTYGNECMLGAATC 54 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 32.3 bits (70), Expect = 0.30 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 EC CP T PVCGSD Y N L A+AC + +++ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNE-CLMQARACATNKTIT 1410 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C +CP T +PVCGSD Q+Y N Sbjct: 1720 CPPSCPNT--LDPVCGSDLQSYDN 1741 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C + CP+T +PVC SD TY N Sbjct: 1580 CPKICPIT--LDPVCASDNNTYPN 1601 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 437 TCP-VTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 TCP + +PVCGSD +TY N R+ +AC Sbjct: 608 TCPECSKREDPVCGSDSKTYPNECRMR-QEAC 638 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 C C T + PVCGSD TY N L QAC + +++ Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVA 1243 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 EC + CP E VCG++++TY+N + QAC Sbjct: 1789 ECPKDCP--KEDAEVCGTNWKTYTNECMMR-KQAC 1820 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +2 Query: 437 TCP--VTPEFNPVCGSDYQTYSN 499 +CP T E P+C SD QTY N Sbjct: 2153 SCPDDCTNETKPICASDGQTYDN 2175 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 C + CP T + PVCGSD +TY N L A AC Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECELKRA-AC 4000 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVH 538 EC C P+ PVCG+D +TY N + A G H Sbjct: 4236 ECPSRC--LPDKEPVCGADGKTYRNLCEIRKASCEGWH 4271 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 434 RTCPVTPEFNPVCGSDYQTYSNPGRLTCAQ 523 RTCP + PVCGSD +TY+N L A+ Sbjct: 238 RTCP--KQDKPVCGSDGKTYTNGCELATAK 265 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGV 535 ++C R CP PVCGSD +YSN AQ V Sbjct: 33 KDCSRPCPRI--LTPVCGSDRVSYSNMCAFRNAQCLAV 68 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 422 EECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCA 520 ++C C + PVCGSD TYSNP L A Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSA 54 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSL 547 C CP E +PVCG+D +TY++ L A+ G V + Sbjct: 206 CHEPCP--SEASPVCGTDMRTYASRCHLQLAKCKGHKVKM 243 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 440 CPV--TPEFNPVCGSDYQTYSNPGRLTCAQAC 529 CP+ T E+ PVCG+D +TY N + A AC Sbjct: 1295 CPIFCTYEYMPVCGTDGKTYGNKCEMR-ASAC 1325 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 443 PVTPEFNPVCGSDYQTYSN 499 P T +++PVC SD QTY N Sbjct: 1816 PCTADYSPVCASDGQTYPN 1834 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQAC 529 C CP+ ++PVCGSD YSN + A AC Sbjct: 1367 CPSICPL--HYSPVCGSDGNMYSNECAMRAA-AC 1397 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSN 499 EC CP ++PVC S+ +TYSN Sbjct: 1595 ECFSACPDI--YDPVCASNGKTYSN 1617 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQA 526 EC+ T E+ PVC SD + Y P R+T A Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIY--PNRMTMENA 1997 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C R CP + PVCGSD +TY+N Sbjct: 1068 CPRRCP--KKLMPVCGSDGKTYNN 1089 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 449 TPEFNPVCGSDYQTYSNPGRLTCAQAC 529 T +++PVCGSD +TY N L A C Sbjct: 33 TLQYDPVCGSDGKTYGNMCFLKAAIKC 59 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 440 CPVTPEFNPVCGSDYQTYSNPGRL 511 CP +F PVCGSD +TY N RL Sbjct: 442 CP--RDFRPVCGSDLRTYVNLCRL 463 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 440 CPVTPEFNPVCGSDYQTYSNPGRL 511 CP E +PVCGSD +TY N +L Sbjct: 513 CP--KEASPVCGSDGKTYENECKL 534 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 437 TCPV--TPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 +CP+ P PVCGSD ++Y + L +AC + L+ Sbjct: 1681 SCPIYCPPSGQPVCGSDGKSYGSECELR-KEACEAKIKLT 1719 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 458 FNPVCGSDYQTYSNPGRLTCAQAC 529 ++PVCGS+ +TY N LT A+AC Sbjct: 1830 YDPVCGSNRKTYLNFCSLT-AEAC 1852 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C CP+ + PVCG+D +T+ N Sbjct: 1538 CSSRCPLV--YKPVCGTDMETHIN 1559 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 446 VTPEFNPVCGSDYQTYSNPGRLTC 517 V +FNPVCG+D TY P C Sbjct: 138 VKSQFNPVCGADDVTYFTPCHAGC 161 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTYSN 499 EC+ CP PVCGSD TY N Sbjct: 80 ECLSECP--DHIKPVCGSDGVTYPN 102 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 425 ECMRTCPVTPEFNPVCGSDYQTY 493 EC C T E+ PVCGSD +TY Sbjct: 46 ECPMAC--TREYAPVCGSDGKTY 66 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +2 Query: 437 TCP--VTPEFNPVCGSDYQTYSN 499 +CP T E++P+CGSD +TY N Sbjct: 5153 SCPDICTFEYSPLCGSDGKTYDN 5175 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 428 CMRTCPVTPEFN-PVCGSDYQTYSN 499 CM C P N PVCGSD +TY+N Sbjct: 5619 CM--CQSCPSINKPVCGSDGKTYNN 5641 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C C T E+ PVCG+D Q+Y N Sbjct: 5224 CNSIC--TLEYAPVCGTDGQSYDN 5245 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSN 499 C R C T + PVCG+D +TY N Sbjct: 39 CNRAC--TKIYRPVCGTDGKTYGN 60 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +2 Query: 428 CMRTCPVTPEFNPVCGSDYQTYSNPGRLTCAQACGVHVSLS 550 C C T + PVCGSD TY N L QAC + +++ Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVA 312 >SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) Length = 374 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 303 GSQIKDRCQIRGNSSSKHQLPLLLLPDPASVE*QR 407 G+ + DR +RGN+ ++ LP PDP ++ Q+ Sbjct: 45 GNIMYDRRIVRGNTYAQRTLPATAQPDPIEIQKQQ 79 >SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) Length = 1007 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/19 (52%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 337 PLIWQRSFIW-DPSLIGET 284 PL+W+RSF W +P ++G T Sbjct: 882 PLLWERSFCWKNPVVLGYT 900 >SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 428 CMRTCPV-TPEFNPVCGSDYQTYSNPGRLTCAQACGV 535 C C T +F PVCG D +Y +P C + G+ Sbjct: 460 CNSACHCSTAQFRPVCGPDGVSYYSPCFAGCKASLGM 496 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,050,069 Number of Sequences: 59808 Number of extensions: 326034 Number of successful extensions: 709 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -