BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B02 (594 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77400.1 68414.m09013 expressed protein 29 2.3 At1g51570.1 68414.m05804 C2 domain-containing protein contains I... 27 9.4 >At1g77400.1 68414.m09013 expressed protein Length = 232 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 152 NSPEELEDRYALNRPNNVRPDRFP 223 +SP +R+ L+RPN +RP+ P Sbjct: 117 SSPRAFSERWQLHRPNRIRPESEP 140 >At1g51570.1 68414.m05804 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 776 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = -1 Query: 147 TCLLFLIFMHVA*LAIKPRIRIVHSLSILNCNNLKNECDQFL 22 TC L M++ + + P++ +H L++ +NL+++ Q + Sbjct: 497 TCSSLLNMMYMYSMPLLPKMHYLHPLTVSQLDNLRHQATQIV 538 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,832,875 Number of Sequences: 28952 Number of extensions: 220482 Number of successful extensions: 482 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -