BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B01 (610 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0491 - 9857895-9858584,9858689-9859270 30 1.6 01_03_0175 + 13450869-13451013,13451293-13451372,13451417-134522... 28 5.0 08_01_0296 + 2383578-2384220,2384754-2384829,2384942-2385057,238... 28 6.7 09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972... 27 8.8 >09_02_0491 - 9857895-9858584,9858689-9859270 Length = 423 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 608 VKAYDGSVLIISVTTGCCSHTSCPPFCS 525 V AYDG V +S+ G +H C CS Sbjct: 58 VAAYDGQVRAVSILLGLDNHRKCAGLCS 85 >01_03_0175 + 13450869-13451013,13451293-13451372,13451417-13452240, 13452287-13452638 Length = 466 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 581 IISVTTGCCSHTSCPPFCSRPSGIE 507 ++ +TGCCS CPP S ++ Sbjct: 152 MVHTSTGCCSAERCPPLSIATSSVD 176 >08_01_0296 + 2383578-2384220,2384754-2384829,2384942-2385057, 2385957-2386522 Length = 466 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 570 NNWMLLTHVVPPVLFPTEWN*KTARLTMTVTQRTMPPSLILSCGS 436 + W +++ P V+ P + K LTMT +R +P S L GS Sbjct: 236 SGWKVISRAKPIVVDPGLYLSKKFDLTMTTERRELPTSFKLYTGS 280 >09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596, 9726900-9727847 Length = 743 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 189 RMISIRGIIFNFKMIFKYD*IQHLQYWI*NFFRITTSSNQRICI 320 R++ + G +F ++ ++HL+Y +FFRIT N+ C+ Sbjct: 528 RLLDLSGCLFQ-ELPTSIGELKHLRYLNVSFFRITELPNEMCCL 570 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,533,190 Number of Sequences: 37544 Number of extensions: 283939 Number of successful extensions: 460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -