BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_B01 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 1.1 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 3.3 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 23 5.8 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.8 bits (54), Expect = 1.1 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -1 Query: 511 LKNSSPDDDGYSADYA-AIFNIILWFGVVFTFTLISIVYALVDMDPGR 371 L NS+P Y A + ++F L + FT L+ +VYAL ++ P R Sbjct: 482 LVNSNPSAILYRASRSKSLFMSTLL--ISFTLALVPVVYALAEIVPSR 527 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = -2 Query: 537 PVLFPTEWN*KTARLTMTVTQRTMPP 460 P+ FPT W R T + PP Sbjct: 352 PIFFPTYWPHYWNRFTQSTAMHNQPP 377 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 557 CSHTSCPPFCSRPSG 513 CS T C PFC SG Sbjct: 154 CSPTKCVPFCRPFSG 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,299 Number of Sequences: 2352 Number of extensions: 12203 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -