BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A18 (633 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp... 29 0.74 SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 27 3.0 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 26 5.2 SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|c... 25 6.9 SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 25 9.1 >SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp9|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 28.7 bits (61), Expect = 0.74 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 7/102 (6%) Frame = +2 Query: 149 SQNVVSSPLSAEYXXXXXXXXXXDPA----HEELLTSLDIPNDDCIRSSFTS-ITSNLKS 313 S+ V+SSP S + + HE+LLT ++ N I S FTS + S L + Sbjct: 102 SRKVISSPYSPKQTHTVLKRLYDRQSVISDHEKLLTPQNVSNSSQILSPFTSLLPSTLST 161 Query: 314 IQGITLNIA-NKVYLKE-GPYELHSELKEDAVKVFDASFEKL 433 ++ L+++ N+ L+ G + + + K +D + +++ Sbjct: 162 LKDTPLSVSQNEKNLETVGEVLVPETVAQHRTKFYDYTLDEM 203 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 26.6 bits (56), Expect = 3.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 329 LNIANKVYLKEGPYELHSELKEDAVKVFDASFEKLNFND 445 L+ ++ YLK+G +EL + D V D F+ ++ D Sbjct: 1255 LSTSDNFYLKQGGFELLDTIITDFSNVMDPDFDDVSLLD 1293 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 25.8 bits (54), Expect = 5.2 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +2 Query: 14 IFLLIVTVSLFLSLPVKSSELTMDAKAISSAVAKFSAKFLNELD 145 +F ++ SLF +L +SSEL +S+A+ + + ++E+D Sbjct: 440 VFQALMLGSLFYNLRNESSELYSRGSVLSNAIVFTAIQTMSEVD 483 >SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.4 bits (53), Expect = 6.9 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +1 Query: 271 YSFLIHFNYIQFEVYTRY 324 ++F+I FNYI+ +Y+R+ Sbjct: 431 HAFIIKFNYIKPSIYSRF 448 >SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 25.0 bits (52), Expect = 9.1 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 582 IPLKYRALTRTTLE 541 + LKYRA+TRTT++ Sbjct: 614 VTLKYRAVTRTTMD 627 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,279,381 Number of Sequences: 5004 Number of extensions: 39898 Number of successful extensions: 141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -