BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A17 (423 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 2.8 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 6.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 2.8 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = -1 Query: 375 IFFFKTSRIVPCCMLVVIFMH 313 I++F ++ CC ++ MH Sbjct: 258 IYYFYYMHLLFCCAFIIFTMH 278 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = -3 Query: 325 HFYALLCLNSLPKL*KLNTPSPFSRKCQLTAPLV 224 HFY L L LN PF + P++ Sbjct: 311 HFYCAFSLYPLKSTFYLNVVRPFPERSMGITPMI 344 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 20.6 bits (41), Expect = 6.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 263 ALLAKMPTDCPARYCPVMLRWARHE*TQPAN 171 +L++ P D ARY P L R P N Sbjct: 11 SLISNTPKDMNARYLPPSLSDTRPMLPYPQN 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,036 Number of Sequences: 336 Number of extensions: 1760 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -