BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A17 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 4.6 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 22 8.0 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.0 bits (47), Expect = 4.6 Identities = 10/34 (29%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 317 IKMTTNMQQ-GTILDVLKKKMRQTKEEMEKYQDE 415 +K+T +Q+ + ++ KK R+TKEE + +++ Sbjct: 64 MKLTVLLQELQAQISIMMKKSRETKEEARRDKEK 97 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 22.2 bits (45), Expect = 8.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 207 QHYGAITSGAVSWHFRE 257 QHYG + + +W+ +E Sbjct: 35 QHYGXLLKASTTWNEKE 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,534 Number of Sequences: 2352 Number of extensions: 7133 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -