BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A16 (504 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1185 - 31562061-31562519,31562962-31563026,31563384-31563420 29 2.8 03_03_0132 + 14711645-14711839,14712641-14712970,14713689-147137... 27 8.6 >04_04_1185 - 31562061-31562519,31562962-31563026,31563384-31563420 Length = 186 Score = 28.7 bits (61), Expect = 2.8 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 256 LVALFDTHATPRHAA-PCHAMSCHLIILFLMHFSLSIEXYTFALFY 390 L L DT+A+P A CH ++C L++ F+ I +T Y Sbjct: 77 LEVLADTNASPFSGAFSCHLLACGLLVHAFSDFTKDICNFTVVALY 122 >03_03_0132 + 14711645-14711839,14712641-14712970,14713689-14713751, 14713833-14713906,14714004-14714099,14714705-14714759, 14714867-14714971,14715054-14715135,14715450-14715562, 14715717-14716118 Length = 504 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 271 DTHATPRHAAPCHAMSCHLIILFLMHFSLSIE 366 D + PR+ P H SC L I F H L+I+ Sbjct: 215 DGRSIPRYLLPEHVTSCCLRISFSAHKDLNIK 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,438,501 Number of Sequences: 37544 Number of extensions: 180070 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -