BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A14 (460 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 26 0.55 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 24 2.9 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 6.8 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 22 9.0 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 22 9.0 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 22 9.0 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 26.2 bits (55), Expect = 0.55 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 19 G*DYETWKSGAGPQRPVRRP 78 G Y W G GP RP RRP Sbjct: 443 GGPYGGWGHGNGPNRPGRRP 462 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.8 bits (49), Expect = 2.9 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 200 IHKRSKIKPFVKGVNYNHLMPT 265 +H++ + P K +N H +PT Sbjct: 33 VHRKDYVNPAFKKINPQHTVPT 54 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.6 bits (46), Expect = 6.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 152 IDRYPRKVHKRMGKNKIHKRS 214 I+ Y VH R G+N I RS Sbjct: 122 IEEYVTMVHNRFGRNPIVIRS 142 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 22.2 bits (45), Expect = 9.0 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 227 FVKGVNYNHLMPTRYSVDFSFEKFSAKDLKDPAKRKKLRFNTRVR 361 F+KG+ Y+ + R + F++ A + D K +RF+ R R Sbjct: 235 FLKGLGYDVSVMVRSILLRGFDQQMATMVGDSMVEKGIRFHHRSR 279 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 22.2 bits (45), Expect = 9.0 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 227 FVKGVNYNHLMPTRYSVDFSFEKFSAKDLKDPAKRKKLRFNTRVR 361 F+KG+ Y+ + R + F++ A + D K +RF+ R R Sbjct: 211 FLKGLGYDVSVMVRSILLRGFDQQMATMVGDSMVEKGIRFHHRSR 255 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 22.2 bits (45), Expect = 9.0 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 227 FVKGVNYNHLMPTRYSVDFSFEKFSAKDLKDPAKRKKLRFNTRVR 361 F+KG+ Y+ + R + F++ A + D K +RF+ R R Sbjct: 208 FLKGLGYDVSVMVRSILLRGFDQQMATMVGDSMVEKGIRFHHRSR 252 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,775 Number of Sequences: 2352 Number of extensions: 10797 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -