BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A13 (361 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 0.83 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 0.83 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 20 7.7 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 0.83 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 285 YLQTCSVSFVWTALNVKTIMECIYI 359 +L TCS F+ + K + CI+I Sbjct: 202 FLTTCSFDFLTDDEDTKVFVTCIFI 226 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 0.83 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 285 YLQTCSVSFVWTALNVKTIMECIYI 359 +L TCS F+ + K + CI+I Sbjct: 202 FLTTCSFDFLTDDEDTKVFVTCIFI 226 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 1.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 145 WVKVAMKSVTIFLSAASDSG 86 +++VA S+T+ L+A SD G Sbjct: 1469 FIEVATNSITLHLNAWSDGG 1488 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +3 Query: 36 TSHQSLLATIAKDGQITPESDAALKKIVTDFIATFTQSQ*KLSLIKDSCN 185 T+ S++A +A T + + A+KK +T I TQS+ +KD N Sbjct: 933 TNASSMIAPVALTAA-TCDQNKAVKKHITTTIDCSTQSEYYELEVKDQKN 981 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.2 bits (40), Expect = 7.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 1 LLSRRNSPSTSRLATRACWPPLLRMVR 81 L+S ++P T R A +PP R+ R Sbjct: 389 LVSGSSTPGTGREHDPAKFPPSFRISR 415 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,517 Number of Sequences: 438 Number of extensions: 1747 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -