BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A13 (361 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 2.8 At5g52547.1 68418.m06523 expressed protein 26 6.6 At5g65800.1 68418.m08279 1-aminocyclopropane-1-carboxylate synth... 26 8.7 At4g38940.1 68417.m05518 kelch repeat-containing F-box family pr... 26 8.7 At1g74800.1 68414.m08666 galactosyltransferase family protein co... 26 8.7 At1g05690.1 68414.m00590 TAZ zinc finger family protein / BTB/PO... 26 8.7 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 10 RRNSPSTSRLATRACWPPLLRMVRSP 87 RR SPS+SR +R+ PP+L SP Sbjct: 607 RRRSPSSSRSPSRSRSPPVLHRSPSP 632 >At5g52547.1 68418.m06523 expressed protein Length = 106 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 9 EKEFTQHIKTSHQSLLATIAKDGQITPESDAALK-KIVTDFIA 134 +KEF + K S ++LL T+ + + + ALK K++TD ++ Sbjct: 62 QKEFELNEKLSKKTLLETLLRKTAPLSDLEMALKNKLITDILS 104 >At5g65800.1 68418.m08279 1-aminocyclopropane-1-carboxylate synthase, putative / ACC synthase, putative similar to ACC synthases from Arabidopsis thaliana [GI:940370], Lycopersicon esculentum [GI:508609], Cucumis sativus [GI:3641649] Length = 470 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 155 LLRLGKGSNEVCDDLLECSIRLGGDLTILSNGGQ 54 ++++G N++C DL+E + D L GQ Sbjct: 40 MIQMGLAENQLCFDLIESWLTKNPDAASLKRNGQ 73 >At4g38940.1 68417.m05518 kelch repeat-containing F-box family protein low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 370 Score = 25.8 bits (54), Expect = 8.7 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 234 SCKWSADIRVCSNSMLFYLQTCSVSFVWTA 323 +CKWS + ++ +LQ + +W A Sbjct: 304 ACKWSKTVSYTGGKLVLFLQKTEKTEIWCA 333 >At1g74800.1 68414.m08666 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 672 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 303 HYKSANRRACCWNKLLYQ 250 HY+S + C W+KLL Q Sbjct: 646 HYQSPRQMICLWDKLLRQ 663 >At1g05690.1 68414.m00590 TAZ zinc finger family protein / BTB/POZ domain-containing protein contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF02135 : TAZ zinc finger; similar to p300/CBP acetyltransferase-related protein (GI:12597461) [Arabidopsis thaliana]; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 364 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 346 SMIVLTFNAVHTNDTLQVCK*KSMLLEQTLISA 248 SM++ F +V + + +V K + LLEQ LI A Sbjct: 181 SMVIKDFKSVSSTEGWKVMKRSNPLLEQELIEA 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,463,649 Number of Sequences: 28952 Number of extensions: 129046 Number of successful extensions: 301 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 301 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -