BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A12 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.011 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 34 0.061 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.19 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.24 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 0.24 SB_49635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.75 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.75 SB_15403| Best HMM Match : CH (HMM E-Value=0) 30 0.99 SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 1.3 SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) 29 2.3 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 28 3.0 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_42991| Best HMM Match : fn3 (HMM E-Value=7.2e-08) 28 4.0 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 28 4.0 SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) 28 4.0 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) 27 5.3 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 27 7.0 SB_44864| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 27 9.2 SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) 27 9.2 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 36.3 bits (80), Expect = 0.011 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 351 DPCMKVHCSARRVC*INEHGEAICNCIKECP 443 DPC V C A + C + G+A C C+ ECP Sbjct: 57 DPCSNVFCHAGQEC-VAAKGKASCECLSECP 86 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 33.9 bits (74), Expect = 0.061 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -2 Query: 279 PPGIVSRPGYPPCRSRGAPTRRCPRGEAPR 190 PPG + PG PP R AP PRG APR Sbjct: 808 PPGGRAAPGGPPLRGGMAPRGAVPRGMAPR 837 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 32.7 bits (71), Expect = 0.14 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 342 NLDDPCMKVHCSAR-RVC*INEHGEAICNCIKECP 443 N DPC CSA C + ++ EA+C C K+CP Sbjct: 1762 NYCDPCQNFICSAPYSSCEVKDN-EAVCECPKDCP 1795 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 32.3 bits (70), Expect = 0.19 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 345 LDDPCMKVHCSARRVC*INEHGEAICNCIKECP 443 L +PC V C + C G A+C C ECP Sbjct: 776 LCNPCKNVECKFKARCVGLPDGSAVCECNTECP 808 Score = 31.5 bits (68), Expect = 0.32 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 345 LDDPCMKVHCSARRVC*INEHGEAICNCIKEC 440 L DPC+K+ C C + G A C C +C Sbjct: 225 LTDPCLKISCKFHSRCVKSSGGSANCVCPSDC 256 Score = 30.3 bits (65), Expect = 0.75 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 354 PCMKVHCSARRVC*INEHGEAICNCIKEC 440 PC ++ CS C + +G+A C C ++C Sbjct: 709 PCSRISCSHYGRCVVRNNGKAHCVCPRQC 737 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 31.9 bits (69), Expect = 0.24 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 276 EAERARVSEILNESRDAPDDEINLDDPCMKVHCSARRVC*INEHGEAICNCIKEC 440 E E + + ++ + D+ L DPC CS + +N +G A C C + C Sbjct: 68 EVESCKTNTRISVIKKGSCDDSALSDPCDIALCSFPQSICVNVNGTATCECPRAC 122 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.9 bits (69), Expect = 0.24 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 282 QPPGIVSRPGYPPCRSRGAPTRRCPRGEAPRTSAAR 175 QPP SR PP SRGAP RG AP AR Sbjct: 286 QPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPAR 321 >SB_49635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 30.3 bits (65), Expect = 0.75 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 252 SLDERRFQEAERARVSEILNESRDAPDDEINLDDPCM 362 SLDE ++ AE +RVS I +S ++ D E D C+ Sbjct: 30 SLDEHKWMVAEMSRVSRI-QQSEESQDKETKQDQACI 65 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 30.3 bits (65), Expect = 0.75 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 333 RQEHRVTHSGSRRHELSQPPGIVSRPGYPPC----RSRGAPTRRCPRGEAP 193 RQ H +T+ R H LS PG +PGY P R R +P+ R PR +P Sbjct: 1320 RQTHTITNV--RGHSLS--PGEAQKPGYSPYPEAERKRDSPSDR-PRSRSP 1365 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 29.9 bits (64), Expect = 0.99 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 345 LDDPCMKVHCSARRVC*INEHGEAICNCIKECP 443 + DPC KV C+ C G C C + CP Sbjct: 1535 MKDPCSKVKCAFYGQCVWYYDGRTQCECRRTCP 1567 >SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.5 bits (63), Expect = 1.3 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 166 RRLPSGRRP-RGFPAGTSPSRSTSRTAWRIAWTRDDSRRL 282 RRLPSGR P R P+G PSR + R+ R SRRL Sbjct: 136 RRLPSGRLPSRRLPSGCLPSRRL--PSGRLPSRRLPSRRL 173 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 166 RRLPSGRRP-RGFPAGTSPSRSTSRTAWRIAWTRDDSRRL 282 RRLPS R P R P+G PSR + R+ R SRRL Sbjct: 166 RRLPSRRLPSRRLPSGCLPSRRGQLPSRRLPSGRLPSRRL 205 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 166 RRLPSGRRPRG-FPAGTSPSR---STSRTAWRIAWTRDDSRRL 282 RRLPSGR P G P+G PSR S + R+ R SRRL Sbjct: 293 RRLPSGRLPSGRLPSGRLPSRRLPSGRLPSGRLPSGRLPSRRL 335 Score = 29.1 bits (62), Expect = 1.7 Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 166 RRLPSGRRPRG-FPAGTSPSR 225 RRLPSGR P G P+G PSR Sbjct: 106 RRLPSGRLPSGRLPSGQLPSR 126 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 166 RRLPSGRRP-RGFPAGTSPSR 225 RRLPSGR P R P+G PSR Sbjct: 368 RRLPSGRLPSRRLPSGRLPSR 388 Score = 27.5 bits (58), Expect = 5.3 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 166 RRLPSGRRP-RGFPAGTSPS-RSTSR--TAWRIAWTRDDSRRL 282 RRLPSGR P R P+G PS R SR + R+ R SRRL Sbjct: 16 RRLPSGRLPSRRLPSGRLPSGRLPSRRLPSRRLPSGRLPSRRL 58 Score = 27.1 bits (57), Expect = 7.0 Identities = 23/49 (46%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 166 RRLPSGRRPRG-FPAGTSPSRSTSRTAWRIAWTRDDSRRL--RELVSPR 303 RRLPSGR P G P+ PSR + R+ R SRRL R L S R Sbjct: 56 RRLPSGRLPSGRLPSRRLPSRRL--PSRRLPSRRLPSRRLPSRRLPSGR 102 Score = 27.1 bits (57), Expect = 7.0 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 169 RLPSGRRPRG-FPAGTSPSRSTSRTAWRIAWTRDDSRRL 282 RLPSGR P G P+G PSR + R+ R SRRL Sbjct: 344 RLPSGRLPSGRLPSGWLPSRRL--PSRRLPSGRLPSRRL 380 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 351 DPCMKVHCSARRVC*INEHGEAICNCIKECP 443 D C KV C C + +G A C+C CP Sbjct: 1513 DVCSKVTCHRYAKCNNHYNGTASCSCSSRCP 1543 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 354 PCMKVHCSARRVC*INEHGEAICNCIKECP 443 PC + C + C ++ +A C C K CP Sbjct: 1337 PCNRTQCPSYSRCVLDSSLQAKCVCTKSCP 1366 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 354 PCMKVHCSARRVC*INEHGEAICNCIKECP 443 PC V C C G +C C+ +CP Sbjct: 1407 PCSTVTCLYHSKCFPQADGTGVCICLDQCP 1436 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 345 LDDPCMKVHCSARRVC*INEHGEAICNCIKECP 443 L DPC+ C C + +A C C + CP Sbjct: 1583 LPDPCLAKRCPPYAQCVPDHVLKARCTCPERCP 1615 >SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) Length = 217 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 348 DDPCMKVHCSARRVC*INEHGEAICNCIKECP 443 +DPC K C +C + G C C CP Sbjct: 11 EDPCSKRVCMWGEMCRADSSGFTYCECPVSCP 42 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 204 RGDISESEHLENGMADSLDERRFQEAERARVSEILNESRD 323 + D E+ L+N M DSLD+ R ++ S I E RD Sbjct: 420 KADSYENISLDNTMVDSLDDDRESVCSNSKKSAIFLEIRD 459 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.9 bits (59), Expect = 4.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 351 DPCMKVHCSARRVC*INEHGEAICNCIKECP 443 DPCM C+A ++ G+A+C C+ CP Sbjct: 180 DPCMTKACTAPYSKCMSVRGKAVCMCM-SCP 209 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 354 PCMKVHCSARRVC*INEHGEAICNCIKECP 443 PC CSA + GEA+C C+ CP Sbjct: 250 PCQTSPCSAPYAKCLVVQGEAVCTCL-SCP 278 >SB_42991| Best HMM Match : fn3 (HMM E-Value=7.2e-08) Length = 769 Score = 27.9 bits (59), Expect = 4.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 202 PAGTSPSRSTSRTAWRIAWTR 264 P G +PS+S +R++W +W R Sbjct: 498 PVGENPSKSRNRSSWPPSWIR 518 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 172 LPSGRRPRGFPAGTSPSRSTSRTAWRIAWTRD 267 LP RR + A P T R WR+ W ++ Sbjct: 404 LPGYRRDNAYIAAQGPLAETCRDFWRMVWEQN 435 >SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 765 Score = 27.9 bits (59), Expect = 4.0 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 225 EHLENGMADSLDERRFQEAERARVSEILNESRDAPDDEINLDD 353 E+L + + D Q ER R++E+ E+RD EIN D Sbjct: 91 ENLSDRLRQKADLTLAQAIERCRMNEMRKENRDLVLGEINKSD 133 >SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) Length = 631 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +3 Query: 195 GLPRGDISESE---HLENGMADSLDERRFQEAERARVSEILNESRDAPDDEINL 347 G+P + +S+ LEN + +DE + ++ ER +V ++L ++ D + L Sbjct: 31 GVPYPQLDQSQTILRLENDLRTKVDELKMEKHERIKVLKVLRDTERQLCDRLRL 84 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 27.9 bits (59), Expect = 4.0 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 351 DPCMKVHCSARRVC*INEHGEAICNC-IKECP 443 +PC + C+ ++ + GE +C C + ECP Sbjct: 1864 NPCGNIKCTHKQQQCVVRSGEPMCECVVNECP 1895 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 351 DPCMKVHCSARRVC*INEHGEAICNCIKECP 443 DPC C + C + +G A C C CP Sbjct: 1572 DPCEITLCDKGKRC-LLVNGTATCECFSACP 1601 >SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) Length = 263 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 327 PDDEINLDDPCMKVHCSARRVC*INEHGEAICNCIK 434 P+ +++D+ CS C IN HG +C C++ Sbjct: 148 PEGCVDIDECVYPRVCSEHAKC-INTHGSYLCTCVE 182 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 134 KTSSTPSALTYDDYRAADVRGASPRGHLRVGAPRERHGG*PGRET 268 ++S TP + T + R +P+G R+ PR R G GR T Sbjct: 342 RSSFTPQSFTPQS-SISRRRSDTPKGRRRISVPRRRAGSAQGRLT 385 >SB_44864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 336 HRQEHRVTHSGSRRHELSQPPGIVSRPG 253 H +EH +TH+G + H+ Q +R G Sbjct: 71 HLKEHLITHTGQKPHQCDQCGKCFTRSG 98 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 342 NLDDPCMKVHCSARRVC*INEHGEAICNC 428 N DD C CS C + G+A C C Sbjct: 220 NFDDECASNPCSENATCVTSFSGKASCIC 248 >SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) Length = 4240 Score = 26.6 bits (56), Expect = 9.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 172 LPSGRRPRGFPAGTSPS-RSTSRTAWRIAWTRDD 270 +P GRR RG G SPS RS R + RD+ Sbjct: 376 IPQGRRSRGSFRGVSPSTRSDHEDDLRELYNRDE 409 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,831,088 Number of Sequences: 59808 Number of extensions: 278489 Number of successful extensions: 941 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -