BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A09 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 24 0.97 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 24 0.97 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 6.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.0 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 24.2 bits (50), Expect = 0.97 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 433 AKAFALRSWSSLWNRLTLPAAVSL 362 AK +++ W+S W L P+A ++ Sbjct: 328 AKTISVQQWNSYWGILGFPSAPTI 351 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 24.2 bits (50), Expect = 0.97 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 433 AKAFALRSWSSLWNRLTLPAAVSL 362 AK +++ W+S W L P+A ++ Sbjct: 328 AKTISVQQWNSYWGILGFPSAPTI 351 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 338 HSHPWFR*QADR 373 H HPWF+ R Sbjct: 127 HEHPWFKKSVQR 138 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 496 SNPPPTVLKSGT*GMLGMFLVAKAFALRSWSSLWNRLTLPAAV 368 S P P VL++ + ++ + F L WS R L A+ Sbjct: 1111 STPAPVVLEAVHASRRVLIVLTRNFLLTEWSRFEFRAALHEAL 1153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,455 Number of Sequences: 438 Number of extensions: 3746 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -