BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A08 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0941 + 32953065-32953089,32954252-32954406,32954486-329545... 30 1.7 08_02_0505 + 17897038-17898870,17899049-17899108,17900034-179001... 28 6.8 03_05_0209 + 22014556-22015308 28 6.8 11_06_0109 + 20202629-20205452,20206354-20206578,20207208-202080... 27 8.9 07_01_0896 - 7508341-7508715,7511746-7511886 27 8.9 >02_05_0941 + 32953065-32953089,32954252-32954406,32954486-32954587, 32955089-32955140,32955237-32955349,32955542-32955610, 32955942-32956049,32956517-32956661,32957245-32957476, 32957567-32957853,32957951-32958087,32958520-32958667, 32959464-32959595,32960239-32960367,32960707-32960834, 32960911-32961075,32961462-32961587,32962088-32962161, 32962285-32962534,32962875-32963054,32963128-32963361, 32964771-32964840,32965065-32965177,32965403-32965511, 32965639-32965688,32965823-32965889,32966131-32966203, 32966393-32966448,32966729-32966831,32967377-32967458, 32967717-32967779,32967918-32967977,32968356-32968448, 32968561-32968623,32968699-32968797 Length = 1363 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 200 NGTTSLISFM*QPSLCANSFGFLGKAPIHTAALTVQTIMD 81 N T + SF+ P+LCA G + P+ AA ++T+ + Sbjct: 965 NYTRDVGSFLDHPTLCARCHGVIDLPPVPAAAAGIETLRE 1004 >08_02_0505 + 17897038-17898870,17899049-17899108,17900034-17900150, 17900352-17900389,17900446-17900641 Length = 747 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 124 ALPKKPKELAHKEGCYIKEINDVV-PFGTELKPIGHCYRITCVGSL 258 AL KP E+ K +N + FG + +G C+ +T VGSL Sbjct: 602 ALGGKPGEVEEKSAGSSPNVNSISRKFGGVVTGVGSCWLLTGVGSL 647 >03_05_0209 + 22014556-22015308 Length = 250 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 253 SLIDYTSCGVVATND---EHCHVTEIDPKKPYPECCPD 357 S D+T+CG D +H H ++P C PD Sbjct: 97 STSDFTACGHTGVGDKQEQHHHQVGVEPSSATESCVPD 134 >11_06_0109 + 20202629-20205452,20206354-20206578,20207208-20208091, 20208692-20208814 Length = 1351 Score = 27.5 bits (58), Expect = 8.9 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 6/82 (7%) Frame = -3 Query: 390 DIDVIF*VTFDIRTAFRIWLLGVYLCDVAMFVI--CSDNTTRSVINQASYT----GNSVA 229 D + + F + + W LG L + ++ C +R +I Q+S T G+ Sbjct: 1264 DTEAVMFFHFGLVSGLCDWSLGGVLRHIVQKIMESCLFPPSRQLIRQSSKTEDKTGDKRK 1323 Query: 228 MSDGLEFCSKRYHIIDFFYVAA 163 + CSKR ++ FF VAA Sbjct: 1324 GGEVSPVCSKRTRLLQFFAVAA 1345 >07_01_0896 - 7508341-7508715,7511746-7511886 Length = 171 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 380 SFSESHLISGQHSGYGFLGSISVTW 306 +F S L GQH+ YGF+ + TW Sbjct: 31 AFGSSILTMGQHTEYGFVPVANPTW 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,024,988 Number of Sequences: 37544 Number of extensions: 306200 Number of successful extensions: 555 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -