BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A05 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0216 - 14954047-14956098 33 0.23 04_03_0922 + 20834195-20836603 31 0.92 05_03_0212 + 10260690-10261272,10261921-10262435,10262446-102625... 30 1.6 08_01_0663 + 5721902-5723176,5724162-5724233,5724405-5724560,572... 29 2.1 04_03_0916 + 20794240-20794246,20794585-20796545 29 2.1 04_03_0913 + 20777859-20780309 28 6.5 12_02_0244 - 16241243-16241279,16241781-16241848,16241930-162420... 27 8.6 11_04_0041 - 12690287-12690816,12691087-12691378 27 8.6 09_03_0172 - 13072575-13073800,13075919-13076054 27 8.6 >11_04_0216 - 14954047-14956098 Length = 683 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 445 FGKRETSAGFPRGLNERRIELLPTGVEVQRCGRSLEEIQFSPQRVV 308 FG GF G+ E+R+E P VE+++C + + +R++ Sbjct: 249 FGSSSDGDGFSDGVEEKRLECDPVSVEIKKCEPPAKSLSSVSRRIL 294 >04_03_0922 + 20834195-20836603 Length = 802 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 148 QPRFQCQSIRH*KPAKYSSSSELQHCRCRSGLHVQG-QDWCICDR 279 QP+ QC P + +EL C+C G ++ +DW + DR Sbjct: 290 QPKVQCDVFAVCGPFTICNDNELGFCKCMKGFSIKSPKDWELDDR 334 >05_03_0212 + 10260690-10261272,10261921-10262435,10262446-10262569, 10262840-10263042,10263169-10263240,10264905-10265007, 10265350-10265582 Length = 610 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = -2 Query: 526 KKNDFLKTMVLNNFXKF*INDCFKLEIFGKRETSAGFPRGLNERRIELLPTGVEVQRCGR 347 K+ F+ + V + + D FK + G PRG ++++ L + + CG Sbjct: 425 KRTPFVDSQVRRSGRLLALRDGFKNILQEDPNMGVGKPRGKAVKKLKQLAEKIGSEMCGT 484 Query: 346 SLEEI 332 SLEE+ Sbjct: 485 SLEEV 489 >08_01_0663 + 5721902-5723176,5724162-5724233,5724405-5724560, 5724655-5724844,5725173-5725255 Length = 591 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 253 LEHVVHSGTDSVEVRNLRNIWQVFSGECFGTEIVVVVME 137 LE + HSG + +V L N W ++ F + VV+V E Sbjct: 417 LELLAHSGEVNKQVPRLSNFWNMYFTHHFQVDTVVMVRE 455 >04_03_0916 + 20794240-20794246,20794585-20796545 Length = 655 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 148 QPRFQCQSIRH*KPAKYSSSSELQHCRCRSGLHVQG-QDWCICDR 279 QP+ QC P + +EL +C C G + +DW + DR Sbjct: 135 QPKAQCDVYSICGPFTVCTDNELPNCNCIKGFTITSLEDWVLEDR 179 >04_03_0913 + 20777859-20780309 Length = 816 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +1 Query: 148 QPRFQCQSIRH*KPAKYSSSSELQHCRCRSGLHVQG-QDWCICDR 279 QP+ C P +EL HC C G V +DW + DR Sbjct: 288 QPKAPCDVYAICGPFTVCIDNELPHCNCIKGFTVTSLEDWELEDR 332 >12_02_0244 - 16241243-16241279,16241781-16241848,16241930-16242032, 16242095-16242256,16242305-16242369,16242547-16242612, 16242738-16242829,16243029-16243134,16243231-16243279, 16243387-16243540,16243661-16243687,16243797-16243959, 16244621-16244701 Length = 390 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -2 Query: 271 RCTNLVLEHVVHSGTDSVEVRN--LRNIWQVFSGECF 167 R NLV+++V HSG + +++ LRN+ FS CF Sbjct: 354 RLQNLVMQNVDHSGGEFIDLLQGLLRNMLFGFSRICF 390 >11_04_0041 - 12690287-12690816,12691087-12691378 Length = 273 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 339 SRLRPHRWTSTPVGRSSIRLSLSPRGNPALVSRFPNIS 452 SRLRP+R S P RS + +S R P+ P S Sbjct: 138 SRLRPNRCLSEPFRRSGTLVFMSGREEPSFAEPEPEPS 175 >09_03_0172 - 13072575-13073800,13075919-13076054 Length = 453 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 319 QRVVITIKDIGVSGGRRCTNLVLEHVV 239 + V++T+KD+ GGR CT L E + Sbjct: 281 RNVILTMKDLTAVGGRFCTYLSKEKAI 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,165,718 Number of Sequences: 37544 Number of extensions: 344421 Number of successful extensions: 863 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -