BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_A02 (562 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 29 0.032 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 29 0.032 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.52 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.52 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.69 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 0.91 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 0.91 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.8 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.8 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 3.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.7 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 4.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 6.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.5 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.5 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 29.1 bits (62), Expect = 0.032 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 389 YFVHFFAPDLPPLNKYVVFVLD 454 Y++H FAP+ P LN Y VLD Sbjct: 182 YYLHQFAPEQPDLNYYNPVVLD 203 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 29.1 bits (62), Expect = 0.032 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 389 YFVHFFAPDLPPLNKYVVFVLD 454 Y++H FAP+ P LN Y VLD Sbjct: 182 YYLHQFAPEQPDLNYYNPVVLD 203 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.0 bits (52), Expect = 0.52 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -2 Query: 459 DVSRTKTTYLLSGGRSGAKKWTKYP----SFTRICPSFGRSTSYCTTN*PKTPSPA 304 D + T L+ +G +K+T Y +FTR+ + +YC T SPA Sbjct: 1163 DEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEEDVPGSPA 1218 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.0 bits (52), Expect = 0.52 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -2 Query: 459 DVSRTKTTYLLSGGRSGAKKWTKYP----SFTRICPSFGRSTSYCTTN*PKTPSPA 304 D + T L+ +G +K+T Y +FTR+ + +YC T SPA Sbjct: 1159 DEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEEDVPGSPA 1214 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 0.69 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Frame = +2 Query: 92 KETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMHVYA 271 K T E++ +I +V + + S + +RE V+T +EEQ ++ V Sbjct: 142 KSTTTTVEVK-RDIINPEDVIVIRRTGEGSKPLFEREEIKNVLTKINKIEEQDTVLVVNI 200 Query: 272 EKS-KES---ATGENA 307 EKS KES AT N+ Sbjct: 201 EKSGKESKKYATSSNS 216 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 0.91 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 4/47 (8%) Frame = +2 Query: 434 YVVFV-LDTSGSMSG--RKMEQLKEAMYTILNELNPGDYFSI-IDFE 562 Y++++ TSG++S RK+ ++++ + T+ +LNP SI DFE Sbjct: 546 YMIYIWFTTSGTISEKFRKLIRIEDDVATLRMKLNPTKAASINADFE 592 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 0.91 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 4/47 (8%) Frame = +2 Query: 434 YVVFV-LDTSGSMSG--RKMEQLKEAMYTILNELNPGDYFSI-IDFE 562 Y++++ TSG++S RK+ ++++ + T+ +LNP SI DFE Sbjct: 599 YMIYIWFTTSGTISEKFRKLIRIEDNVATLRMKLNPTKAASINADFE 645 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 2.8 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +2 Query: 92 KETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMHVYA 271 K T E++ +I +V + + S I +RE V+T +EE ++ V Sbjct: 142 KSTTTTVEVK-RDIINPEDVILIRRTGEGSKPIFEREEIKNVLTKINKIEEHDTVLVVNI 200 Query: 272 EK----SKESATGENA 307 EK SK+ AT N+ Sbjct: 201 EKSGNESKKYATSSNS 216 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 480 LRPDMDPDVSRTKTTYLLSGGRSGAKKWTKYPSF 379 L+ + + ++SR T Y SGG +++ P F Sbjct: 190 LKSENNTELSRVGTKYHRSGGLMNVERFPYQPPF 223 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 414 SGAKKWTKYPSFTRICPSFGRSTSYCT 334 S A K+ YP T+IC S S+ T Sbjct: 131 SCAMKFESYPHDTQICSMMIESLSHTT 157 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +2 Query: 425 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 553 L K+++ + + +M+ +++ +L+ M NEL P D +I Sbjct: 448 LEKFMI-LCNLMRTMNRKQISELESNMQISPNELKPNDKSQVI 489 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 171 ASSFVASTSFPVLISGTR 118 AS+F+A +FP + S TR Sbjct: 185 ASNFIAMETFPSVYSKTR 202 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 Query: 125 PEIRTGNEVDATKDDAQMSNVIIQREGT 208 P++ N D D +NV+++ GT Sbjct: 108 PDVLMYNSADEGFDGTYPTNVVVKNNGT 135 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 23 VYQHVVNLHPGSLVPKFTVTVHIKETANI 109 ++ H+ L+PG P F T ++ A I Sbjct: 104 LHDHLGTLYPGMRAPSFRCTERPEDGALI 132 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 23 VYQHVVNLHPGSLVPKFTVTVHIKETANI 109 ++ H+ L+PG P F T ++ A I Sbjct: 104 LHDHLGTLYPGMRAPSFRCTERPEDGALI 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,843 Number of Sequences: 438 Number of extensions: 3383 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -