BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P15 (430 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB007919-1|BAA32295.3| 1182|Homo sapiens KIAA0450 protein protein. 29 6.7 AK093158-1|BAC04078.1| 144|Homo sapiens protein ( Homo sapiens ... 29 8.8 >AB007919-1|BAA32295.3| 1182|Homo sapiens KIAA0450 protein protein. Length = 1182 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -3 Query: 359 MTSARVASSSCWCSVRGSAFRGGPHRA---GGSAGRW 258 + SA + C CS GS GG HRA G AG W Sbjct: 11 LRSAWALRAGCPCSGWGSGDAGGQHRARCPSGRAGNW 47 >AK093158-1|BAC04078.1| 144|Homo sapiens protein ( Homo sapiens cDNA FLJ35839 fis, clone TESTI2006659. ). Length = 144 Score = 28.7 bits (61), Expect = 8.8 Identities = 20/48 (41%), Positives = 24/48 (50%) Frame = -3 Query: 350 ARVASSSCWCSVRGSAFRGGPHRAGGSAGRWVSRVSWASQLGHSAPQR 207 AR A SS W + GS ++ G H G A R WAS+ G PQR Sbjct: 81 ARFAHSS-WKAALGSCYQPGFHTCQGQARLGSVRGVWASEHG-VQPQR 126 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,644,615 Number of Sequences: 237096 Number of extensions: 819672 Number of successful extensions: 2700 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2698 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -