BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P13 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32848| Best HMM Match : S-antigen (HMM E-Value=8.5e-05) 29 4.4 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_32848| Best HMM Match : S-antigen (HMM E-Value=8.5e-05) Length = 555 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 472 YNKIITKFTGQNEKQHVLKNKQTYIFIYRL*TVWLSQES 356 Y K++ + + HVLK KQ I + + T+WL Q S Sbjct: 52 YAKLLGHQNNKQKIHHVLKLKQENISLKTITTIWLDQGS 90 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -1 Query: 562 TLNQ*YEREHRLRRTSHICYWFLITLPVLPYNKII 458 TL + Y + +R TSH+ +WF + + +LP + I+ Sbjct: 44 TLLKLYYLDLFIRLTSHVLHWFPVPVELLPRSLIL 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,494,076 Number of Sequences: 59808 Number of extensions: 277389 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -