BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P12 (373 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.18 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 29 0.99 At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 ... 28 2.3 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 28 2.3 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 27 3.0 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 3.0 At1g14700.1 68414.m01757 purple acid phosphatase, putative conta... 27 4.0 At5g45520.1 68418.m05591 hypothetical protein 27 5.3 At4g24150.1 68417.m03465 expressed protein ; expression supporte... 26 7.0 At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to R... 26 7.0 At3g54020.1 68416.m05973 phosphatidic acid phosphatase-related /... 26 9.2 At2g15520.1 68415.m01776 zinc finger protein, putative strong si... 26 9.2 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 26 9.2 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 31.5 bits (68), Expect = 0.18 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 135 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPLARGG 284 ++A P P+ P+ GP P+S+ PA N+P Y +P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 29.1 bits (62), Expect = 0.99 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +3 Query: 108 PSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPLARGG 284 P NS+HV + P F+ PS P ++ FN P PP + +PL+ G Sbjct: 73 PYGQNSEHVPPSAPS--FTSPSQPPPSPPATSLNPNSYSTFNQPPPPPTIHPQPLSSYG 129 >At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 (SCL11) identical to cDNA scarecrow-like 11 (SCL11) mRNA, partial cds gi:4580526 Length = 172 Score = 27.9 bits (59), Expect = 2.3 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +3 Query: 96 NSGVPSDGNSD--HVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKP 269 N G PS +S+ + P+ +PS G+ + + + N PN P+ +DKP Sbjct: 82 NGGNPSSSSSNGGKKSFSEPESSKVEPSGETDGDLKRKQSEVVSEEQNRPNKSPRSFDKP 141 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 168 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDKP 269 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 Score = 25.8 bits (54), Expect = 9.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 144 NPDPFFSQPSNGPSGNYEPISTGP 215 NP+P++S P + P+ + S+ P Sbjct: 316 NPEPYYSSPHSAPAPSSTSFSSAP 339 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 27.5 bits (58), Expect = 3.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +3 Query: 147 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDKPLAR 278 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 3.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 7 SDTIRQ*KLSCFSSSPYWPWLP 72 S I + + SC SSP+ PW+P Sbjct: 96 SKIIEEKRYSCIISSPFTPWVP 117 >At1g14700.1 68414.m01757 purple acid phosphatase, putative contains Pfam profile: PF00149 calcineurin-like phosphoesterase; similar to purple acid phosphatase (GI:20257479) [Arabidopsis thaliana] Length = 366 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 Query: 113 RWNTTIVHHVNSVCGSHGQYGEEEKH 36 +W I HH G HG E EKH Sbjct: 239 KWKIVIGHHTIKSAGHHGNTIELEKH 264 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 321 SFKIANLYETFTSHHGREVCRIAW 250 SFK+ +L E+ T G E +IAW Sbjct: 524 SFKVESLMESLTGLQGLESLKIAW 547 >At4g24150.1 68417.m03465 expressed protein ; expression supported by MPSS Length = 493 Score = 26.2 bits (55), Expect = 7.0 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +3 Query: 75 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 221 N+ + +SG+ + S + DPFFS S+G G AF Sbjct: 102 NQAYTSSHSGMFTPAGSGSAAVTVADPFFSLSSSGEMRRSMNEDAGAAF 150 >At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to RNA helicase SDE3 [Arabidopsis thaliana] GI:13811296 Length = 1002 Score = 26.2 bits (55), Expect = 7.0 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 99 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHP 239 SG SD + F ++G SG Y P GP V P Sbjct: 4 SGYKSDDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFP 50 >At3g54020.1 68416.m05973 phosphatidic acid phosphatase-related / PAP2-related Length = 305 Score = 25.8 bits (54), Expect = 9.2 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -3 Query: 311 SLIFMRHLLPTTGERFVVSLGWIIGMIE 228 +L+F+R +RF+ LGW+I +++ Sbjct: 185 TLVFVRTYQKYGSKRFIKLLGWVIAILQ 212 >At2g15520.1 68415.m01776 zinc finger protein, putative strong similarity to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 483 Score = 25.8 bits (54), Expect = 9.2 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +3 Query: 138 IANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDKPLAR 278 +A PF P+ G +E STG N PPK KP R Sbjct: 385 LALSQPFTDSPTVYSPGLFETGSTGTFQKKAKQRNRPPKHARKPKPR 431 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 144 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 +P P S PS+ P + P S P + + P PP Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 72 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 144 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 +P P S PS+ P + P S P + + P PP Sbjct: 86 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,117,563 Number of Sequences: 28952 Number of extensions: 160949 Number of successful extensions: 457 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -