BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P11 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces pom... 27 2.5 SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosacch... 25 7.7 >SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 286 Score = 26.6 bits (56), Expect = 2.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 236 ISFF--IRVTAVCDVFSLLQYIDRWTSANYRIS 144 ISFF + +T+ D F+++ I RWT A IS Sbjct: 35 ISFFHDVPLTSDKDTFNMVTEIPRWTQAKCEIS 67 >SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 25.0 bits (52), Expect = 7.7 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +3 Query: 27 KINMNSVRILIFVAICVMFVSTVTAWDFFKELEGVGQRVRDAIISAGPAIDVLQ 188 K++ + L+FV CV V+ +FK G ++ A+ AGP DVLQ Sbjct: 261 KLDSFVYQCLLFVGKCVNRVTPYLERFWFKC--HYGSKLGTALQVAGPGFDVLQ 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,888,793 Number of Sequences: 5004 Number of extensions: 33129 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -