BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P07 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 29 2.8 SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 28 4.9 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 28 6.5 SB_18870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 112 FGDKVTAAGKVNLFH---NDNHDITAKAFATRNMPDIANVPNFNTV 240 FGDK A + FH ND D + + TR + D++ +P + TV Sbjct: 587 FGDKWIGANTIRAFHHTDNDGIDASENSNLTRIIFDLSTLPMYETV 632 >SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 72 RPRSKSHGYTHPRVRRQGDSC 134 RP S+SHG HPRV D+C Sbjct: 92 RPTSQSHGNRHPRVPIDKDNC 112 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 75 PRSKSHGYTHPRVRRQGDSC 134 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 75 PRSKSHGYTHPRVRRQGDSC 134 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 28.3 bits (60), Expect = 4.9 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = -3 Query: 360 TLEEVQLSVQGVIVTIDEVRVSGGR*CTNLIFEHIVYSATDSVEVGYISDIWHISGGESL 181 T ++V L+ + V +T D+V ++ +L + + TD V + +D++ S G L Sbjct: 458 TGDDVHLTSEHVHLTSDDVHLTSDD--VHLTSDD--GNLTDDVHLTS-NDVYLTSDGVHL 512 Query: 180 RCDVVVIVVEEIHFAGSCHLVSE 112 D V + +++H G HL S+ Sbjct: 513 TSDDVHLTGDDVHLTGDVHLTSD 535 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 22 RQKLGAATAGVALDNVNGHGVSLTDTHIPGFGDKVTAAGKVNLFHND 162 R + + T +++ + +G+GVSLT + FG K+ + K+ + +ND Sbjct: 443 RTDVTSGTTHLSVVDADGNGVSLTSSINKYFGSKIRSK-KLGIIYND 488 >SB_18870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = -1 Query: 464 KYLESENPKLGSQEDFMKGVSNFLKPALKSTEVSGLLKRFSFP 336 KY++S++ + +D ++ V++F+K E LL+RF FP Sbjct: 46 KYVQSKHIHVYPCDD-LRWVASFMKDGKTFEEAIALLRRFHFP 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,470,291 Number of Sequences: 59808 Number of extensions: 366865 Number of successful extensions: 1064 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1059 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -