BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_P01 (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S... 155 1e-38 At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) riboso... 154 2e-38 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 28 2.0 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 28 2.0 At2g24180.1 68415.m02889 cytochrome P450 family protein 28 2.0 At5g35753.1 68418.m04282 expressed protein 27 6.1 At3g28890.1 68416.m03606 leucine-rich repeat family protein cont... 27 6.1 At1g77300.1 68414.m09002 SET domain-containing protein similar t... 26 8.0 >At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S ribosomal protein L5 GB:P49625 from [Oryza sativa] Length = 301 Score = 155 bits (375), Expect = 1e-38 Identities = 68/102 (66%), Positives = 82/102 (80%) Frame = +2 Query: 41 MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 220 M FVK K+ YFKRYQVKF+RRR+GKTDY AR RL+ QDKNKYNTPKYR +VR +NKD+ Sbjct: 1 MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 Query: 221 TCQVAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTG 346 Q+ + I GD + +AY+HELP+YG+ VGLTNYAAAYCTG Sbjct: 61 VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTG 102 >At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) ribosomal protein L5, rice Length = 301 Score = 154 bits (373), Expect = 2e-38 Identities = 68/102 (66%), Positives = 82/102 (80%) Frame = +2 Query: 41 MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 220 M FVK K+ YFKRYQVKF+RRR+GKTDY AR RL+ QDKNKYNTPKYR +VR +NKD+ Sbjct: 1 MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 Query: 221 TCQVAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTG 346 Q+ + I GD + +AY+HELP+YG+ VGLTNYAAAYCTG Sbjct: 61 VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTG 102 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 28.3 bits (60), Expect = 2.0 Identities = 14/58 (24%), Positives = 32/58 (55%) Frame = +2 Query: 59 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 232 VKN + + ++ KR+ EGKT+ +K++ +D+ + P + +SN + + ++ Sbjct: 79 VKNNGHSRAITLQNKRKPEGKTEKREKKKIKAEDETE---PSMKGKSNMSNTETSSEI 133 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 28.3 bits (60), Expect = 2.0 Identities = 14/58 (24%), Positives = 32/58 (55%) Frame = +2 Query: 59 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 232 VKN + + ++ KR+ EGKT+ +K++ +D+ + P + +SN + + ++ Sbjct: 79 VKNNGHSRAITLQNKRKPEGKTEKREKKKIKAEDETE---PSMKGKSNMSNTETSSEI 133 >At2g24180.1 68415.m02889 cytochrome P450 family protein Length = 503 Score = 28.3 bits (60), Expect = 2.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 355 QQQTSAVGSSIVSQTHLDTIAWEFMRVGSTDNVITLN 245 Q Q + +GSS ++ TH+ I + G +VITL+ Sbjct: 281 QSQETKLGSSRITDTHIRAIIMDLFVAGVDTSVITLD 317 >At5g35753.1 68418.m04282 expressed protein Length = 592 Score = 26.6 bits (56), Expect = 6.1 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 107 RREGKTDYYARKRL-VVQDKNKYNTPKYRLIVRLSNKDVTCQ 229 RR G+ DYY +KRL Y +Y + + NK ++C+ Sbjct: 79 RRSGEIDYYLQKRLDTFWTVCTYCKVQYEYLRKYVNKRLSCK 120 >At3g28890.1 68416.m03606 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 711 Score = 26.6 bits (56), Expect = 6.1 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Frame = -3 Query: 358 CQQQTSAVGSSIVSQTHLDTIAWEFMR--------VGSTDNVITLNA*VCNLTGNI 215 C Q + V SSI + +HL T+ F R +G ++ TLN V N G I Sbjct: 178 CNQFSGQVPSSIGNLSHLTTLELSFNRFFGQFPSSIGGLSHLTTLNLFVNNFLGQI 233 >At1g77300.1 68414.m09002 SET domain-containing protein similar to huntingtin interacting protein 1 [Homo sapiens] GI:12697196; contains Pfam profile PF00856: SET domain Length = 1759 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 65 NKQYFKRYQVKFKRRREGKTDYYAR 139 N+Q+ KR VKF+R + GK Y R Sbjct: 1017 NQQFQKRKYVKFERFQSGKKGYGLR 1041 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,101,069 Number of Sequences: 28952 Number of extensions: 153120 Number of successful extensions: 426 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -