BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O23 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27522| Best HMM Match : PspB (HMM E-Value=0.56) 29 2.6 SB_16998| Best HMM Match : Filamin (HMM E-Value=0.0037) 28 4.6 >SB_27522| Best HMM Match : PspB (HMM E-Value=0.56) Length = 314 Score = 28.7 bits (61), Expect = 2.6 Identities = 20/75 (26%), Positives = 34/75 (45%) Frame = -1 Query: 430 KDYATTINAQVIKSASTEVHVGLSPTRVQRTRLLTLVINADMGGKKMRTQTLTRYRDGFA 251 KD+ T N SA + + + + +L +V +K R++ LT+Y DG Sbjct: 188 KDFQTDFNIFEKDSAIFQDGLRIFGATLAFLVVLAIVWEIIYRKRKRRSKNLTKYEDGEL 247 Query: 250 *MDAGNRHLNPQCTH 206 M + N+ L+P H Sbjct: 248 AMASHNKRLSPAEIH 262 >SB_16998| Best HMM Match : Filamin (HMM E-Value=0.0037) Length = 284 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 82 GRRSSQPMKTWRALQRRAPSSAAP 11 GRR S TWR R+ P+S AP Sbjct: 121 GRRKSSGGDTWRVYIRQGPASLAP 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,483,147 Number of Sequences: 59808 Number of extensions: 153945 Number of successful extensions: 389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -