BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O23 (481 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026187-1|AAH26187.1| 330|Homo sapiens cyclin N-terminal domai... 29 8.5 AK097456-1|BAC05060.1| 330|Homo sapiens protein ( Homo sapiens ... 29 8.5 >BC026187-1|AAH26187.1| 330|Homo sapiens cyclin N-terminal domain containing 1 protein. Length = 330 Score = 29.1 bits (62), Expect = 8.5 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 309 SALMTNVNNRVRCTRVGDNPTWTSVDADFITCALIVVA*SLSLQNHLCY 455 S L ++ N G+ +TSV DF+ A+ ++A S +QNH C+ Sbjct: 226 SLLRASIENSTPSQLQGEK--FTSVKEDFMLLAVGIIAASAFIQNHECW 272 >AK097456-1|BAC05060.1| 330|Homo sapiens protein ( Homo sapiens cDNA FLJ40137 fis, clone TESTI2012776. ). Length = 330 Score = 29.1 bits (62), Expect = 8.5 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 309 SALMTNVNNRVRCTRVGDNPTWTSVDADFITCALIVVA*SLSLQNHLCY 455 S L ++ N G+ +TSV DF+ A+ ++A S +QNH C+ Sbjct: 226 SLLRASIENSTPSQLQGEK--FTSVKEDFMLLAVGIIAASAFIQNHECW 272 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,378,270 Number of Sequences: 237096 Number of extensions: 670697 Number of successful extensions: 2203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2203 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4270724850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -