BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O22 (542 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82277-1|CAB05248.1| 648|Caenorhabditis elegans Hypothetical pr... 28 5.0 U12921-1|AAB60256.1| 648|Caenorhabditis elegans sex determinati... 28 5.0 Z82267-3|CAB05191.1| 186|Caenorhabditis elegans Hypothetical pr... 27 6.6 >Z82277-1|CAB05248.1| 648|Caenorhabditis elegans Hypothetical protein LLC1.1 protein. Length = 648 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +1 Query: 166 NTVGGGLEYMFKDKIGASASAAHTDFFNKNDYNLGGKLNLFKTPSTSLD 312 N VGG L +D G A H F K+D N +L LF T+ D Sbjct: 176 NLVGGHLSDALQDVSGGVAETLHVRKFLKDDPN-DTELKLFNDLKTAFD 223 >U12921-1|AAB60256.1| 648|Caenorhabditis elegans sex determination protein. Length = 648 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +1 Query: 166 NTVGGGLEYMFKDKIGASASAAHTDFFNKNDYNLGGKLNLFKTPSTSLD 312 N VGG L +D G A H F K+D N +L LF T+ D Sbjct: 176 NLVGGHLSDALQDVSGGVAETLHVRKFLKDDPN-DTELKLFNDLKTAFD 223 >Z82267-3|CAB05191.1| 186|Caenorhabditis elegans Hypothetical protein F38C2.5 protein. Length = 186 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 139 PTISHLPSTNTVGGGLEYMFKDKIGASASAAHTDF 243 P + S GL F D GASAS++ TDF Sbjct: 151 PLMPQFSSWFAPSSGLSREFLDNFGASASSSSTDF 185 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,205,571 Number of Sequences: 27780 Number of extensions: 251615 Number of successful extensions: 574 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -