BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O20 (358 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 25 2.6 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 24 8.0 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 25.4 bits (53), Expect = 2.6 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 179 DGTSGAMVKVPXTGNENHKLSALGFVDLTNQIKLGAATAGLVYDNVNRHGATLTNTHIPG 358 D +SGA++ V T + G + T+ I T+G V + V T+T T I G Sbjct: 792 DTSSGAVIVVEPTAGTVTETIVSGSIPFTSTIPAQGTTSGTV-EVVEPTAGTVTETIISG 850 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 23.8 bits (49), Expect = 8.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 194 HLRFHQN*L*VHPLAGAPWNWSTAP 120 HL F++N + HPLA STAP Sbjct: 115 HLPFYENYIRNHPLAIEALQKSTAP 139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,245,824 Number of Sequences: 5004 Number of extensions: 19071 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 107972554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -