BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O20 (358 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 1.5 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 3.4 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 22 6.0 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 22 7.9 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 7.9 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 252 KPRALSL*FSFPVIGTLTIAPEVPSE 175 +PRAL + +F + TLT+ P V S+ Sbjct: 6 EPRALGIVLAFLSVLTLTLLPPVSSQ 31 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +2 Query: 146 RRQAGELTINSDGTSGAMVKVPXTGNENHKLSALGFVDLTNQIKLGAATAGLV 304 R +AG ++ ++G+S P + K L F+D + A A +V Sbjct: 885 RSEAGGRSLCTNGSSSGRDSQPSSARSTPKKQNLKFIDEASTPSTSAMAATIV 937 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.2 bits (45), Expect = 6.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 237 SVLLASLISLTKLNWGPLQLD*FTIMSTATEL 332 ++LL +IS T+ NW +L F + + TEL Sbjct: 956 TLLLPYIIS-TRRNWASCKLRVFALANRKTEL 986 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 160 TRLPAHPGTGP 128 T LP PGTGP Sbjct: 17 TSLPVAPGTGP 27 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 165 LQLILMEPQVLWSRYRXLETKITSSV 242 LQ L++ Q WSR +ITS++ Sbjct: 1006 LQFHLLQSQEKWSRIAEAAKQITSAL 1031 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 325,037 Number of Sequences: 2352 Number of extensions: 6069 Number of successful extensions: 44 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -