BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O18 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 85 3e-17 At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 72 2e-13 At2g18720.1 68415.m02180 eukaryotic translation initiation facto... 30 1.0 At1g34720.1 68414.m04316 hypothetical protein 28 3.2 At4g05300.1 68417.m00803 hypothetical protein 27 5.5 At3g43380.1 68416.m04591 hypothetical protein 27 5.5 At3g24370.1 68416.m03060 hypothetical protein 27 5.5 At1g27800.1 68414.m03403 hypothetical protein 27 5.5 At5g52550.1 68418.m06525 expressed protein 27 7.3 At3g43680.1 68416.m04657 hypothetical protein 27 7.3 At3g58610.1 68416.m06532 ketol-acid reductoisomerase identical t... 27 9.7 >At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 85.0 bits (201), Expect = 3e-17 Identities = 48/160 (30%), Positives = 83/160 (51%), Gaps = 3/160 (1%) Frame = +2 Query: 2 LKGFEPQQRIKLARMTALWIG---NGCVPPSVLLVLVNEHLLKDNLALEFVLEVFATVKQ 172 L+ FE +R KLA TAL +G P +V L+ ++L+ + L FV + F Sbjct: 135 LELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVAKGIVLSFVTDFFKEYLV 194 Query: 173 ERGVASLIAALKRGQLEGRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQASQEARR 352 E + LI+ L+RG++E L++FLP RRS + A F + GL +L+ H + + R Sbjct: 195 ENSLEDLISILRRGKMEDNLMDFLPPVRRSAESFAEHFTNEGLTDLVEYHSKKMFEVKLR 254 Query: 353 ELTQALLDELAEEKPVRDLIQDLRDMALKHSIPEHETIAI 472 E+ L ++ EE V ++I+ ++ +P+ E + + Sbjct: 255 EIKTVLTSKVTEESNVDEVIESVKQQIKDAKLPDIEVVRV 294 >At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|P47823 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Oryctolagus cuniculus}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 72.1 bits (169), Expect = 2e-13 Identities = 44/160 (27%), Positives = 79/160 (49%), Gaps = 3/160 (1%) Frame = +2 Query: 2 LKGFEPQQRIKLARMTALWIG---NGCVPPSVLLVLVNEHLLKDNLALEFVLEVFATVKQ 172 L+ FE +R KLA TAL +G +V L+ + L+ + L FV + F Sbjct: 135 LELFEENERKKLAIFTALAFSQKLSGLPAETVFQPLLKDTLVAKGIVLNFVTDFFNEYLV 194 Query: 173 ERGVASLIAALKRGQLEGRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQASQEARR 352 E + LI+ L+RG+++ +LLEFLP +R+ + A F GL L+ + + + + Sbjct: 195 ENSLDDLISILRRGKMDDKLLEFLPPTKRTTESFAEHFTKAGLTALVEYNERKIFEVKLK 254 Query: 353 ELTQALLDELAEEKPVRDLIQDLRDMALKHSIPEHETIAI 472 E+ L ++ EE V ++ + ++ +PE E + + Sbjct: 255 EIKAVLTSQVTEEINVDEVTEMVKQQVKDAKLPETEVVHV 294 >At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2 subunit 3, putative / eIF2S3, putative / eIF-2-gamma, putative Length = 465 Score = 29.9 bits (64), Expect = 1.0 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Frame = +2 Query: 5 KGFEPQQRI-KLARMTALWIGNGCVPPSVLLVLVNEHLLKDNLALEFVLEVFATVKQERG 181 K E Q R+ KL + L + G + +++ V + ++K NL L + V R Sbjct: 378 KETERQMRVSKLVKGEILMLNIGSMSTGAMVIGVKKDMVKVNLTLPVCTSIGEKVAISRR 437 Query: 182 VASLIAALKRGQLEGRLLEFLP 247 V + RGQ+E F+P Sbjct: 438 VDRHWRLIGRGQIEAGTTIFIP 459 >At1g34720.1 68414.m04316 hypothetical protein Length = 176 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 224 GRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQA-SQEARR 352 G L+FLP++ + ++ +T A +AE++ H +Q ++ ARR Sbjct: 129 GNHLDFLPISEKFWEMTSTLEAGHAVAEMVMYHISQLHTENARR 172 >At4g05300.1 68417.m00803 hypothetical protein Length = 387 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 224 GRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQA-SQEARR 352 G L+FLP++ + ++ T A +AE++ H +Q ++ ARR Sbjct: 129 GNHLDFLPISEKFWEMTPTLEAGHAVAEMVMYHISQLHTENARR 172 >At3g43380.1 68416.m04591 hypothetical protein Length = 215 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 224 GRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQA-SQEARR 352 G L+FLP++ + ++ T A +AE++ H +Q ++ ARR Sbjct: 129 GNHLDFLPISEKFWEMTPTLEAGHAVAEMVMYHISQLHTENARR 172 >At3g24370.1 68416.m03060 hypothetical protein Length = 187 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 224 GRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQA-SQEARR 352 G L+FLP++ + ++ T A +AE++ H +Q ++ ARR Sbjct: 129 GNHLDFLPISEKFWEMTPTLEAGHAVAEMVMYHISQLHTENARR 172 >At1g27800.1 68414.m03403 hypothetical protein Length = 211 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 224 GRLLEFLPLNRRSEDVLATSFASRGLAELLRLHRAQA-SQEARR 352 G L+FLP++ + ++ T A +AE++ H +Q ++ ARR Sbjct: 129 GNHLDFLPISEKFWEMTPTLEAGHAVAEMVMYHISQLHTENARR 172 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 27.1 bits (57), Expect = 7.3 Identities = 23/78 (29%), Positives = 39/78 (50%) Frame = +2 Query: 251 NRRSEDVLATSFASRGLAELLRLHRAQASQEARRELTQALLDELAEEKPVRDLIQDLRDM 430 NRR E +ATS A R E + + + EA E A + A++K RD ++ ++ Sbjct: 37 NRRLEKAIATSAAIRAELEKKKQMKKEGQLEAADEEDSA---DAAKKKQERDELERIKQA 93 Query: 431 ALKHSIPEHETIAINMAV 484 K + E ++IA + A+ Sbjct: 94 ENKKNRLE-KSIATSAAI 110 >At3g43680.1 68416.m04657 hypothetical protein Length = 539 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 326 AQASQEARRELTQALLDELAEEKPVRDLIQDLRD 427 A+ASQ ARRE ++A L AE + LI+ L + Sbjct: 423 ARASQMARREASEAKLKAAAETRGNAQLIKALEE 456 >At3g58610.1 68416.m06532 ketol-acid reductoisomerase identical to ketol-acid reductoisomerase, chloroplast precursor (EC 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) (Swiss-Prot:Q05758) [Arabidopsis thaliana] Length = 591 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +2 Query: 8 GFEPQQRIKLARMTALWIGNGCVPPSVLLVLVNEHLLKDNLALEFVLEVFATVK 169 GF L +TA GNG S+ +V+ +K ++L+F VF K Sbjct: 38 GFLSSSSKSLRSLTATVAGNGATGSSLAARMVSSSAVKAPVSLDFETSVFKKEK 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,985,914 Number of Sequences: 28952 Number of extensions: 117465 Number of successful extensions: 445 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -