BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O17 (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.1 SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 29 1.5 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 29 1.9 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 29 1.9 SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_24975| Best HMM Match : ET (HMM E-Value=1) 27 5.9 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 1.1 Identities = 25/63 (39%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 407 LPAAVT-LSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 231 LPAAV + P V+ TP L ATP VA LVK+K P L I K Sbjct: 256 LPAAVPPIKTKPAAPSPVKATPTVAPLVKATPMVAP-----LVKAKLPQPLRILYICEEK 310 Query: 230 GTL 222 GT+ Sbjct: 311 GTV 313 >SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 339 RPRSKSHGYTHPRVRRQGDSC 401 RP S+SHG HPRV D+C Sbjct: 92 RPTSQSHGNRHPRVPIDKDNC 112 >SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 242 LPAKGTLTPA-PEVPSELSVRAPCASLRTLELVNSSGSS 129 L AKG L+ P E +RAPC+SL E SSG S Sbjct: 13 LEAKGRLSERRPSAKCESILRAPCSSLEDKESDESSGLS 51 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 29.5 bits (63), Expect = 1.5 Identities = 24/95 (25%), Positives = 45/95 (47%) Frame = +1 Query: 145 LTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKNIVSAIGSLDLTNRQKLGAATAGVA 324 L R +DA + D T ++ F N + V G ++ R + + T ++ Sbjct: 398 LGDPRYMKDADKVVKKMVDQTHSNNLR-KFIDNRTHPVKYYGPINY--RTDVTSGTTHLS 454 Query: 325 LDNVNGHGVSLTDTHIPGFGDKVTAAGKVNLFHND 429 + + +G+GVSLT + FG K+ + K+ + +ND Sbjct: 455 VVDADGNGVSLTSSINKYFGSKIRSK-KLGIIYND 488 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 342 PRSKSHGYTHPRVRRQGDSC 401 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 336 KRPRSKSHGYTHPRVRRQGDSC--RQSESLPQRLPRHHRRKLSP 461 +R S+S T PR RR+ S + S S + PRH RR SP Sbjct: 60 RRSFSRSKSRTPPRHRRRSRSPNKKHSRSKSRTPPRHRRRSRSP 103 >SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 342 PRSKSHGYTHPRVRRQGDSC 401 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.1 bits (62), Expect = 1.9 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -1 Query: 407 LPAAVTL-SPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 231 LP V+L S PG TP P +L+S TP+ + L K+ P++L+ S P Sbjct: 1042 LPVPVSLTSKTPGPVSLTSKTPGPVSLTSKTPSPVS----LTSKTPGPVSLSSKTSGPVS 1097 Query: 230 GT-LTPAP 210 T TP P Sbjct: 1098 LTSKTPGP 1105 >SB_24975| Best HMM Match : ET (HMM E-Value=1) Length = 316 Score = 27.5 bits (58), Expect = 5.9 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -1 Query: 446 PVMSW*SLWKRFTLPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEP 267 P SW L R + LSP+ + SV +TP LS + A+ S V P Sbjct: 74 PPSSWIPLKHRVPVTTNTPLSPSASVTASVSVTP-NTPLSPSASVTASVS----VTPNTP 128 Query: 266 IALTIFLSLPAKGTLTP-APEVPS 198 ++L+ S+ A ++TP P+ PS Sbjct: 129 LSLS--ASVTASVSVTPNTPQSPS 150 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 372 PRVRRQGDSCRQSESLPQRLPRHHRRKLSPP 464 P RR+ R+S S P+R PR SPP Sbjct: 1079 PEDRRRSRGSRRSPSPPKREPRRRSPSASPP 1109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,000,529 Number of Sequences: 59808 Number of extensions: 304308 Number of successful extensions: 972 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -