BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O17 (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 35 0.032 At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM... 29 1.6 At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almo... 29 2.1 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 28 2.8 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 28 3.7 At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein ... 27 4.8 At1g71320.1 68414.m08232 S locus F-box-related / SLF-related con... 27 4.8 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 27 4.8 At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containi... 27 6.4 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 27 6.4 At3g12350.1 68416.m01540 F-box family protein ; similar to SKP1... 27 6.4 At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family... 27 8.5 At2g37690.1 68415.m04622 phosphoribosylaminoimidazole carboxylas... 27 8.5 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 34.7 bits (76), Expect = 0.032 Identities = 25/56 (44%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 300 RRCNRWSGTG*CKRPRSKSHGYTHPRVRRQGDSCRQSESLPQRLPRHHRRKL-SPP 464 R C GTG R RSKS T PR RR R+S S R P RR+ SPP Sbjct: 112 RECRNRGGTG---RRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPP 164 >At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM) identical to SP|Q42510; contains Pfam profile PF01369: Sec7 domain Length = 1451 Score = 29.1 bits (62), Expect = 1.6 Identities = 22/63 (34%), Positives = 32/63 (50%) Frame = +1 Query: 73 GVQSRYLIVSEPVYYIQHYEEPELLTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKN 252 GV S Y IVS+PV E ++ S + A GA +L DG G G + P + D + Sbjct: 249 GVDSDYAIVSKPVEDGNANSEYDVENS--MATFATGAQSLMDDGPVGPGSRKPASPYDLH 306 Query: 253 IVS 261 I++ Sbjct: 307 IMT 309 >At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almost identical to DegP protease precursor GB:AF028842 from [Arabidopsis thaliana] (J. Biol. Chem. 273 (12), 7094-7098 (1998)) Length = 439 Score = 28.7 bits (61), Expect = 2.1 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = -1 Query: 371 MCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAKGTLTPAPEVPSEL 192 +C SV L+ F+L +A+PAV + S +V + + + ++ TP+ + L Sbjct: 83 LCTSVALS---FSLFAASPAVESAS-AFVVSTPKKLQTDELATVRLFQENTPSVVYITNL 138 Query: 191 SVRAPCASLRTLELVNSSGS 132 +VR +L LE+ SGS Sbjct: 139 AVRQDAFTLDVLEVPQGSGS 158 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 28.3 bits (60), Expect = 2.8 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 398 AVTLSPNPGMCVSVRLTPWPFTLSSAT--PAVAAPSFCLLVKS 276 +++ S NPG+C P P S AT P + P+ + KS Sbjct: 268 SISFSGNPGLCGGPTRNPCPIPSSPATVSPPTSTPALAAIPKS 310 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -1 Query: 407 LPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK 273 L A+ LS G+C LTP+ T + A+ P L+K + Sbjct: 1804 LQASQALSRLTGLCADESLTPYNATAADVLKALLTPKLASLLKDE 1848 >At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 456 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 401 AAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK--EPIALT 255 ++++ SP+P + + P+P +L + P+ ++ L+ S EPI T Sbjct: 366 SSLSYSPSPSSLTDMPVAPYPSSLGTLAPSSSSDQCTELISSSSIEPITTT 416 >At1g71320.1 68414.m08232 S locus F-box-related / SLF-related contains F-box domain Pfam:PF00646; contains TIGRFAM TIGR01640: F-box protein interaction domain; similar to S locus F-box (SLF)-S2-like protein (GI:13161528) [Antirrhinum hispanicum] Length = 392 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 371 MCVSVRLTPWPFTLSSATPAVA 306 M +S WPFTLS TPA+A Sbjct: 144 MKLSPEFMQWPFTLSYLTPAMA 165 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 410 TLPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPS 297 +LP + N + S LTP FT ++A PA P+ Sbjct: 342 SLPPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPA 379 >At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 593 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 277 DLTNRQKLGAATAGVALDNVNGHGVSLT 360 +L N + G TAGV N NG+GV T Sbjct: 180 NLGNLNQTGPVTAGVNYGNNNGYGVKRT 207 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 384 RQGDSCRQSESLPQRLPRHHRRKLSPP 464 R GD R S P+R R H R SPP Sbjct: 142 RHGDYKRTSHRSPRRRYRSHSRSRSPP 168 >At3g12350.1 68416.m01540 F-box family protein ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 422 Score = 27.1 bits (57), Expect = 6.4 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = -2 Query: 172 RPCGL*SLSIVQAPHSVEYSKQVR*QSGIGFERRRTERQAIKRRSSRTCLCTERQLK 2 R G S ++ +P+ E Q+ ++ G +RRR +R+ +R++SRT E LK Sbjct: 204 RSSGDESDDLISSPNFSEMYTQLANKTSPGGDRRRQKRKEKERQASRTKWEPEHFLK 260 >At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family protein Length = 513 Score = 26.6 bits (56), Expect = 8.5 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 11/83 (13%) Frame = -1 Query: 392 TLSPNPGMCVSVRLTPWPFTLSS--ATPAVAAPSFCLLVKSKEPIALTIFLSLPAK---- 231 T +P+ G S TP SS ATP+ AP+ L S P +F S PA Sbjct: 409 TSNPSSGAGFSFLNTPASGPSSSLFATPSSTAPTSSLFGPSPTPTQTPLFGSSPASTFGS 468 Query: 230 -----GTLTPAPEVPSELSVRAP 177 G TP+ +PS+ P Sbjct: 469 TQSLFGQTTPSLTMPSQFGGATP 491 >At2g37690.1 68415.m04622 phosphoribosylaminoimidazole carboxylase, putative / AIR carboxylase, putative similar to SP|P55195 Phosphoribosylaminoimidazole carboxylase, chloroplast precursor (EC 4.1.1.21) (AIR carboxylase) (AIRC) {Vigna aconitifolia}; contains Pfam profiles PF02222: ATP-grasp domain, PF00731: AIR carboxylase Length = 642 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 426 VVEEIHFAGSCHLVSEPGDV 367 VVE IH CH+V P DV Sbjct: 293 VVETIHRDNICHIVKAPADV 312 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,182,005 Number of Sequences: 28952 Number of extensions: 201976 Number of successful extensions: 676 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -