BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O16 (582 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 31 0.91 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 30 1.2 SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) 28 4.8 SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 28 6.4 SB_44142| Best HMM Match : Taeniidae_ag (HMM E-Value=2.7) 27 8.5 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) 27 8.5 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.9 bits (69), Expect = 0.39 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +1 Query: 55 EDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAA 234 +++P V+ + TIN + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 235 TAGLAY-DNVNGHGATLT-KTHIPGFGDKMTAAGKVN 339 ++Y DN+N A T + IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 30.7 bits (66), Expect = 0.91 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +1 Query: 271 GATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQ-VPNFNTVGAG 441 G+T T IPG G + GK ++ N H S A P VP T GAG Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGAG 379 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -1 Query: 132 GTIRVDSESTRL---PAHPRVSPLLRLILILFD---VVTRLFNKHVTAV 4 G + V+ + RL HPR SPLL+L+ D VV LF +HV AV Sbjct: 614 GKVAVEEKRPRLLRSEFHPRRSPLLQLLSNTPDVHVVVVELFQRHVHAV 662 >SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) Length = 1325 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 159 YGYLDHSTGGTIRVDSESTRLPAHPRVSPL 70 Y YL H T T + DS STR+ RV L Sbjct: 935 YAYLHHDTRTTCKYDSYSTRIYTATRVRQL 964 >SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.3 bits (60), Expect = 4.8 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 250 YDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQVPNFNT 429 Y NGH L ++ P T V F NN+DFS++ A N PN+ F Sbjct: 273 YTPTNGH-FQLDESVFPNSDSPDTRDQTVESFEINNNDFSSQENAQSN-PNLDNNDRFRP 330 Query: 430 V 432 V Sbjct: 331 V 331 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 215 WLVRSTEPRALSLWFSLPVMGTLTIAPEVPSELIV 111 W+V ++EP LS + ++ T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 >SB_44142| Best HMM Match : Taeniidae_ag (HMM E-Value=2.7) Length = 95 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 555 VLKRFQFSRPRE*SLRVKDIGVCGGRRCT 469 +LKRF+F E +LR++ VC R C+ Sbjct: 59 LLKRFRFRASHEKNLRIRHTSVCCIRGCS 87 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 201 D*TKSTELVVFIASYGYLDHSTGGTIRVDSES 106 D +K+ E + IA++ L+H+ G I DSES Sbjct: 800 DLSKALEDIKNIAAFNVLEHAKSGEIESDSES 831 >SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) Length = 349 Score = 27.5 bits (58), Expect = 8.5 Identities = 27/126 (21%), Positives = 55/126 (43%) Frame = +1 Query: 169 ENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFH 348 +N+K S D ++ K A T+GLA + +G ++P +++ K N Sbjct: 83 DNYKKKKTKSKDNNSETKAKAGTSGLAKNKTKDNGT----PNLPSLFERIK---KKNNAT 135 Query: 349 NNNHDFSAKAFATKNMPNIPQVPNFNTVGAGVDYMFKDKIGASATAAHTDVFNPQRLLSG 528 N S + P +P++ +F+T + + +S + +H D+ ++L +G Sbjct: 136 KNGETTSQVTINSSGTPALPKLASFDTENSSL------VTSSSTSGSHVDI---EKLSNG 186 Query: 529 AGKLES 546 + K S Sbjct: 187 SIKESS 192 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.130 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,618,148 Number of Sequences: 59808 Number of extensions: 423943 Number of successful extensions: 653 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -