BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O14 (604 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 29 0.040 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 25 0.49 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 25 0.65 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 25 0.65 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 23 2.0 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 2.0 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.0 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 3.5 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 8.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 28.7 bits (61), Expect = 0.040 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 466 TSTLSVPEWTTCSKIKLVHLRPPHTPXSLTATTTLW 573 +ST + P WTT + + RP T + TTT W Sbjct: 1044 SSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNW 1079 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 25.0 bits (52), Expect = 0.49 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = -3 Query: 233 TELVVFIASYGYLDHSTGGTIRVDSESTRLPAHPRVSPLLRLILILFDVVTRLFNKHVTA 54 T L+V I + +ST I S ++P + + P+ L+ I+ DV+ + N H Sbjct: 341 TFLIVMI-QFEMTQNSTN--INFVSTFFKIPFYSTLRPINLLVQIILDVILLILNVHTIL 397 Query: 53 VDADQENR 30 + N+ Sbjct: 398 TTITKRNQ 405 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 24.6 bits (51), Expect = 0.65 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = -3 Query: 149 RLPAHPRVSPLLRLILILFDVVTRLFNKHVTAVDADQENR 30 ++P + + P+ L+ I+ DV+ + N H + N+ Sbjct: 46 KIPFYSTLRPINLLVQIILDVILLILNVHTILTTITKRNQ 85 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 24.6 bits (51), Expect = 0.65 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = -3 Query: 149 RLPAHPRVSPLLRLILILFDVVTRLFNKHVTAVDADQENR 30 ++P + + P+ L+ I+ DV+ + N H + N+ Sbjct: 46 KIPFYSTLRPINLLVQIILDVILLILNVHTILTTITKRNQ 85 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 308 ERTRSDPHKNSYPWVR*QND 367 E + S+P N YPW++ D Sbjct: 158 ENSVSEPPANFYPWMKAHGD 177 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 308 ERTRSDPHKNSYPWVR*QND 367 E + S+P N YPW++ D Sbjct: 158 ENSVSEPPANFYPWMKAHGD 177 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 308 ERTRSDPHKNSYPWVR*QND 367 E + S+P N YPW++ D Sbjct: 158 ENSVSEPPANFYPWMKAHGD 177 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 3.5 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +3 Query: 36 LLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGN 215 +L +N+ E P + E QP Q S + + T +S K P +GN Sbjct: 378 ILNAINAALKSDEIPPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKTPESGN 437 Query: 216 EN 221 E+ Sbjct: 438 ES 439 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 369 AAGKVNLFHNNNHDFSAKAFATKNMPNI 452 AA K+N FH + D + F +++P++ Sbjct: 235 AASKLNSFHWHITDSHSFPFTAESLPDL 262 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 469 STLSVPEWTTCSKIKLVHLRPPHTPXS 549 ++ SVPE T + + RPP TP + Sbjct: 395 NSYSVPEPTISTTPRPEWARPPSTPSA 421 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,926 Number of Sequences: 336 Number of extensions: 2962 Number of successful extensions: 18 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -