BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O14 (604 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large... 27 2.1 SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pom... 26 3.7 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 26 4.9 SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces p... 25 8.5 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 25 8.5 SPBC428.18 |cdt1||replication licensing factor Cdt1|Schizosaccha... 25 8.5 SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces p... 25 8.5 >SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large subunit Rpc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1405 Score = 27.1 bits (57), Expect = 2.1 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +3 Query: 129 SRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYD-- 302 S + +++G + + +GT G + G K S +++ + + + AA + + Sbjct: 1228 SVINQESGKIELFMEGT-GLQAVMNTEGIVGTKTSTNHVMEMKDVLGIEAARYSIISEIG 1286 Query: 303 -NVNGHGATLTKTHIPGFGDKMTAAGKV 383 + HG T+ HI GD MT G+V Sbjct: 1287 YTMAKHGLTVDPRHIMLLGDVMTCKGEV 1314 >SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 458 LRNIWHVFSGECFGT--EIVVVVMEEIYFTGSRHFV 357 + IW V SG+C T E + V + + FT +R ++ Sbjct: 203 MARIWDVLSGQCLKTLVEPINVPLSNLQFTENRKYL 238 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 25.8 bits (54), Expect = 4.9 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +3 Query: 231 SALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNN 404 +A SV++ N ++ +A++G +NG GA T F + NL HNNN Sbjct: 1036 TAGASVEIQNNIE--SASSGGDKTQLNGPGADQPVTATITFDKTSPWRNRENLSHNNN 1091 >SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 25.0 bits (52), Expect = 8.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 300 DNVNGHGATLTKTHIPGFGDKMTAAGKVNL 389 +N AT T T GFGDK + AGK N+ Sbjct: 251 ENKESTTATSTLTDA-GFGDKSSTAGKHNV 279 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 25.0 bits (52), Expect = 8.5 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +3 Query: 171 DGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPG 350 D +SGA++ V T + GS+ T+ + T+G + V T+T+T I G Sbjct: 792 DTSSGAVIVVEPTAGTVTETIVSGSIPFTSTIPAQGTTSG-TVEVVEPTAGTVTETIISG 850 >SPBC428.18 |cdt1||replication licensing factor Cdt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 444 Score = 25.0 bits (52), Expect = 8.5 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = +1 Query: 292 WLMTT*TDTERPSQKLISLGSVTK*RLPVKXXXXXXXXXXXVPKHSPLKTCQIFLKFRTS 471 WL+ ++TE P+Q+L +L S++K + + + T + KF T+ Sbjct: 192 WLLEHCSETEIPAQQLQALPSLSKNTVNESSLVRKLNLEKSTSRELRIPTQTLEPKFTTN 251 Query: 472 TLS-VPEWTTCSKI 510 T E +CS + Sbjct: 252 TAKYANELVSCSML 265 >SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 258 Score = 25.0 bits (52), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 467 VRNLRNIWHVFSGEC 423 + N R++WH F G C Sbjct: 126 IHNYRDLWHSFKGMC 140 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,415,397 Number of Sequences: 5004 Number of extensions: 49044 Number of successful extensions: 118 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -