BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O12 (548 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75544-4|CAA99880.1| 307|Caenorhabditis elegans Hypothetical pr... 31 0.41 AF026203-1|AAB71246.2| 506|Caenorhabditis elegans Hypothetical ... 27 8.9 >Z75544-4|CAA99880.1| 307|Caenorhabditis elegans Hypothetical protein K02A11.3 protein. Length = 307 Score = 31.5 bits (68), Expect = 0.41 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 543 ETALYTLCFMARPDR-PCKLRYNNIAFTIQTKTLKSDNVLLIDTAYP 406 + ALYT+CF++R R C + ++ I + + N + I + YP Sbjct: 245 DMALYTMCFLSRRGRETCDVEFDGCPLQITSFEIMQQNKVYIGSIYP 291 >AF026203-1|AAB71246.2| 506|Caenorhabditis elegans Hypothetical protein E03E2.1 protein. Length = 506 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = +1 Query: 280 HTNIGYK*R*NVNN----CVTFKNDYYSKLLFFF*EYYNVSRRLKK 405 H ++ R NV+N C T +ND+YS L FFF E++N + ++K Sbjct: 237 HLISNFQSRKNVDNNNGICCT-ENDHYSLLGFFF-EHHNEKKLIEK 280 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,017,406 Number of Sequences: 27780 Number of extensions: 189241 Number of successful extensions: 275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -