BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O11 (341 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 23 3.1 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 4.1 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 4.1 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 4.1 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 4.1 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 22 5.5 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 5.5 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 22 7.2 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 21 9.6 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 21 9.6 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 21 9.6 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 74 LIPKGTVFFRPIFALTRK 21 +IP+GT F IFAL R+ Sbjct: 29 VIPRGTNFLFSIFALHRR 46 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQNYWDR 160 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQNYWDR 160 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 128 RKYPVLRYRFETMD-DLQDYWDR 149 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 128 RKYPVLRYRFETMD-DLQDYWDR 149 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 129 RKYLILRYFFEQIGADLPAYPER 61 RKY +LRY FE + DL Y +R Sbjct: 139 RKYPVLRYRFETMD-DLQDYWDR 160 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 74 LIPKGTVFFRPIFAL 30 +IPKGT+ PI+AL Sbjct: 397 VIPKGTMIQIPIYAL 411 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 18 EFSCQGKNWAKKDRPF 65 EF C+ NW K+ R + Sbjct: 262 EFRCKWNNWTKQRRNY 277 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 113 KMRYFLSYLFVLLVGLTIPIFSLYYLLNGKGEQIS 217 K ++ L + VG+T ++YL + GE+++ Sbjct: 244 KTLFYTVNLIIPCVGITFLTVLVFYLPSDSGEKVT 278 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 74 LIPKGTVFFRPIFALTRK 21 LIP+GT +FAL R+ Sbjct: 237 LIPRGTTVVVSLFALHRR 254 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 113 KMRYFLSYLFVLLVGLTIPIFSLYYLLNGKGEQIS 217 K ++ L + VG++ ++YL + GE+IS Sbjct: 238 KTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKIS 272 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 101 LSKLELIYPLIPKGTVFFR 45 L +L +YP IPK F R Sbjct: 621 LGELTYLYPTIPKQEAFGR 639 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,315 Number of Sequences: 2352 Number of extensions: 7826 Number of successful extensions: 68 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24075240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -