BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O10 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr... 28 0.86 SPAC23D3.03c |||GTPase activating protein |Schizosaccharomyces p... 26 4.6 SPAC2G11.10c |||URM1 activating enzyme |Schizosaccharomyces pomb... 26 4.6 SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22... 25 6.1 SPBC18H10.20c |||conserved fungal protein|Schizosaccharomyces po... 25 8.0 SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharo... 25 8.0 SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|ch... 25 8.0 >SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr 2|||Manual Length = 1250 Score = 28.3 bits (60), Expect = 0.86 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 151 LYYNIVIGRYVSAARITMELKNEGRGEVIRLVVNKLLAESKRN 279 + +N I +Y+ + + +E K E EV + KLL+ S +N Sbjct: 185 IQFNSTIPKYIQYSHVDLETKEETLVEVSGRSLRKLLSSSSKN 227 >SPAC23D3.03c |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 472 Score = 25.8 bits (54), Expect = 4.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 490 MSWKIIPHWWNQRAYFEIVNKQFGQYLKL 576 MS + HWW+++ Y + + G LK+ Sbjct: 18 MSKSVRKHWWSRKGYHPTGSSKNGSRLKI 46 >SPAC2G11.10c |||URM1 activating enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 401 Score = 25.8 bits (54), Expect = 4.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 483 TLPFV-FVTVRTSIAISVCTPFEFKSICISEIDKL 382 T P + F+ VR + +C FK+I +SE+D L Sbjct: 313 TSPHITFLDVREPVQFGICRLPLFKNIPLSEVDSL 347 >SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1680 Score = 25.4 bits (53), Expect = 6.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 157 YNIVIGRYVSAARITMELKNEGRGEVIRLVVNKLL 261 Y I+I R ++ +I +KN+ G+V L+ + +L Sbjct: 1556 YYIIIKRPIALGKIKRNIKNDRYGDVGELIADFML 1590 >SPBC18H10.20c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 361 Score = 25.0 bits (52), Expect = 8.0 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 454 AYGDKNEWESDRMSWKIIPH 513 A D N+W+ +R++W++ H Sbjct: 208 AQNDGNDWKINRVTWRLEEH 227 >SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharomyces pombe|chr 3|||Manual Length = 686 Score = 25.0 bits (52), Expect = 8.0 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +1 Query: 367 LGEQVKFINLRDANALKLEWGTDRDGDRGAYGDKNEWESDRMSWK 501 L + + +N +A E G+D D ++ + +E++ D +W+ Sbjct: 63 LDDNISALNSLQRSASSSEKGSDEDNEKLGSSEDDEFDDDFDTWE 107 >SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 216 Score = 25.0 bits (52), Expect = 8.0 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 481 SDRMSWKIIPHWW 519 + R+++K +PHWW Sbjct: 92 TSRITYKNVPHWW 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,287,689 Number of Sequences: 5004 Number of extensions: 43759 Number of successful extensions: 136 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -